Recombinant Human DDX31 Protein, GST-tagged
Cat.No. : | DDX31-2482H |
Product Overview : | Human DDX31 full-length ORF ( NP_619526.1, 1 a.a. - 585 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a member of this family. The function of this member has not been determined. Alternative splicing of this gene generates multiple transcript variants encoding different isoforms. [provided by RefSeq, Apr 2016] |
Molecular Mass : | 90.75 kDa |
AA Sequence : | MAPDLASQRHSESFPSVNSRPNVILPGREGRREGLPPGGGTRGSLVPTRPVPPSPAPLGTSPYSWSRSGPGRGGGAGSSRVPRGVPGPAVCAPGSLLHHASPTQTMAAADGSLFDNPRTFSRRPPAQASRQAKATKRKYQASSEAPPAKRRNETSFLPAKKTSVKETQRTFKGNAQKMFSPKKHSVSTSDRNQEERQCIKTSSLFKNNPDIPELHRPVVKQVQEKVFTSAAFHELGLHPHLISTINTVLKMSSMTSVQKQSIPVLLEGRDALVRSQTGSGKTLAYCIPVVQSLQAMESKIQRSDGPYALVLVPTRELALQSFDTVQKLLKPFTWIVPGVLMGGEKRKSEKARLRKGINILISTPGRLVDHIKSTKNIHFSRLRWLVFDEADRILDLGFEKDITVILNAVNAECQKRQNVLLSATLTEGVTRLADISLHDPVSISVLDKSHDQLNPKDKAVQEVCPPPAGDKLDSFAIPESLKQHVTVVPSKLRLVCLAAFILQKCKFEEDQKMVVFFSSCELVEFHYSLFLQTLLSSSGAPASGQLPSASMRLKFLRLHGGMEQEERTAVFQEFSHSRRGVLLCT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DDX31 DEAD (Asp-Glu-Ala-Asp) box polypeptide 31 [ Homo sapiens ] |
Official Symbol | DDX31 |
Synonyms | DDX31; DEAD (Asp-Glu-Ala-Asp) box polypeptide 31; DEAD/H (Asp Glu Ala Asp/His) box polypeptide 31; probable ATP-dependent RNA helicase DDX31; FLJ13633; FLJ14578; FLJ23349; PPP1R25; protein phosphatase 1; regulatory subunit 25; helicain; G2 helicase; DEAD box protein 31; DEAD/DEXH helicase DDX31; protein phosphatase 1, regulatory subunit 25; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 31; |
Gene ID | 64794 |
mRNA Refseq | NM_022779 |
Protein Refseq | NP_073616 |
MIM | 616533 |
UniProt ID | Q9H8H2 |
◆ Recombinant Proteins | ||
DDX31-2482H | Recombinant Human DDX31 Protein, GST-tagged | +Inquiry |
DDX31-2586HF | Recombinant Full Length Human DDX31 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DDX31-7009HCL | Recombinant Human DDX31 293 Cell Lysate | +Inquiry |
DDX31-7010HCL | Recombinant Human DDX31 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DDX31 Products
Required fields are marked with *
My Review for All DDX31 Products
Required fields are marked with *