Recombinant Human DDX54 protein, GST-tagged
| Cat.No. : | DDX54-301250H |
| Product Overview : | Recombinant Human DDX54 (778-881 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Asp778-Met881 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | DDRDSDEEGASDRRGPERRGGKRDRGQGASRPHAPGTPAGRVRPELKTKQQILKQRRRAQKLHFLQRGGLKQLSARNRRRVQELQQGAFGRGARSKKGKMRKRM |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | DDX54 DEAD (Asp-Glu-Ala-Asp) box polypeptide 54 [ Homo sapiens ] |
| Official Symbol | DDX54 |
| Synonyms | DDX54; DEAD (Asp-Glu-Ala-Asp) box polypeptide 54; ATP-dependent RNA helicase DDX54; APR 5; DP97; MGC2835; DEAD box protein 54; DEAD box helicase 97 KDa; DEAD box RNA helicase 97 kDa; ATP-dependent RNA helicase DP97; |
| Gene ID | 79039 |
| mRNA Refseq | NM_001111322 |
| Protein Refseq | NP_001104792 |
| MIM | 611665 |
| UniProt ID | Q8TDD1 |
| ◆ Recombinant Proteins | ||
| DDX54-4428M | Recombinant Mouse DDX54 Protein | +Inquiry |
| DDX54-2502H | Recombinant Human DDX54 Protein, GST-tagged | +Inquiry |
| DDX54-301250H | Recombinant Human DDX54 protein, GST-tagged | +Inquiry |
| DDX54-2278M | Recombinant Mouse DDX54 Protein, His (Fc)-Avi-tagged | +Inquiry |
| DDX54-9540Z | Recombinant Zebrafish DDX54 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DDX54-460HCL | Recombinant Human DDX54 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DDX54 Products
Required fields are marked with *
My Review for All DDX54 Products
Required fields are marked with *
