Recombinant Human DDX54 protein, GST-tagged

Cat.No. : DDX54-301250H
Product Overview : Recombinant Human DDX54 (778-881 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Asp778-Met881
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : DDRDSDEEGASDRRGPERRGGKRDRGQGASRPHAPGTPAGRVRPELKTKQQILKQRRRAQKLHFLQRGGLKQLSARNRRRVQELQQGAFGRGARSKKGKMRKRM
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name DDX54 DEAD (Asp-Glu-Ala-Asp) box polypeptide 54 [ Homo sapiens ]
Official Symbol DDX54
Synonyms DDX54; DEAD (Asp-Glu-Ala-Asp) box polypeptide 54; ATP-dependent RNA helicase DDX54; APR 5; DP97; MGC2835; DEAD box protein 54; DEAD box helicase 97 KDa; DEAD box RNA helicase 97 kDa; ATP-dependent RNA helicase DP97;
Gene ID 79039
mRNA Refseq NM_001111322
Protein Refseq NP_001104792
MIM 611665
UniProt ID Q8TDD1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DDX54 Products

Required fields are marked with *

My Review for All DDX54 Products

Required fields are marked with *

0
cart-icon
0
compare icon