Recombinant Human DDX55 Protein, GST-tagged
Cat.No. : | DDX55-2503H |
Product Overview : | Human DDX55 full-length ORF ( AAH35911.1, 1 a.a. - 207 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of protein family containing a characteristic Asp-Glu-Ala-Asp (DEAD) motif. These proteins are putative RNA helicases, and may be involved in a range of nuclear processes including translational initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Multiple alternatively spliced transcript variants have been found for this gene. Pseudogenes have been identified on chromosomes 1 and 12. [provided by RefSeq, Feb 2016] |
Molecular Mass : | 50.7 kDa |
AA Sequence : | MKPQRNTADLLPKLKSMALADRAVFEKGMKAFVSYVQAYAKHECNLIFRLKDLDFASLARGFALLRMPKMPELRGKQFPDFVPVDVNTDTIPFKDKIREKQRQKLLEQQRREKTENEGRRKFIKNKAWSKQKAKKEKKKKMNEKRKREEGSDIEDEDMEELLNDTRLLKKLKKGKITEEEFEKGLLTTGKRTIKTVDLGISDLEDDC |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DDX55 DEAD (Asp-Glu-Ala-Asp) box polypeptide 55 [ Homo sapiens ] |
Official Symbol | DDX55 |
Synonyms | DDX55; DEAD (Asp-Glu-Ala-Asp) box polypeptide 55; ATP-dependent RNA helicase DDX55; KIAA1595; DEAD box protein 55; FLJ16577; MGC33209; |
Gene ID | 57696 |
mRNA Refseq | NM_020936 |
Protein Refseq | NP_065987 |
UniProt ID | Q8NHQ9 |
◆ Recombinant Proteins | ||
DDX55-28326TH | Recombinant Human DDX55, His-tagged | +Inquiry |
DDX55-2503H | Recombinant Human DDX55 Protein, GST-tagged | +Inquiry |
DDX55-2658HF | Recombinant Full Length Human DDX55 Protein, GST-tagged | +Inquiry |
DDX55-9503Z | Recombinant Zebrafish DDX55 | +Inquiry |
DDX55-1334C | Recombinant Chicken DDX55 | +Inquiry |
◆ Cell & Tissue Lysates | ||
DDX55-7002HCL | Recombinant Human DDX55 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DDX55 Products
Required fields are marked with *
My Review for All DDX55 Products
Required fields are marked with *