Recombinant Human DDX60 protein, His-tagged
| Cat.No. : | DDX60-425H |
| Product Overview : | Recombinant Human DDX60 protein(NP_060101.3)(1363-1712 aa), fused to His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1363-1712 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
| AA Sequence : | PLSITLVLRLMLLASKGDDPEDTKAKVLSVLKHSLLSFKQPRVMDMLKLYFLFSLQFLVKEGYLDQEGNPMGFAGLVSHLHYHEPSNLVFVSFLVNGLFHDLCQPTRKGSKHFSQDVMEKLVLVLAHLFGRRYFPPKFQDAHFEFYQSKVFLDDLPEDFSDALDEYNMKIMEDFTTFLRIVSKLADMNQEYQLPLSKIKFTGKECEDSQLVSHLMSCKEGRVAISPFVCLSGNFDDDLLRLETPNHVTLGTIGVNRSQAPVLLSQKFDNRGRKMSLNAYALDFYKHGSLIGLVQDNRMNEGDAYYLLKDFALTIKSISVSLRELCENEDDNVVLAFEQLSTTFWEKLNKV |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | DDX60 DEAD (Asp-Glu-Ala-Asp) box polypeptide 60 [ Homo sapiens ] |
| Official Symbol | DDX60 |
| Gene ID | 55601 |
| mRNA Refseq | NM_017631.5 |
| Protein Refseq | NP_060101.3 |
| MIM | 613974 |
| UniProt ID | Q8IY21 |
| ◆ Recombinant Proteins | ||
| DDX60-3433H | Recombinant Human DDX60 protein, His&Myc-tagged | +Inquiry |
| DDX60-4253H | Recombinant Human DDX60 Protein, GST-tagged | +Inquiry |
| DDX60-4879HF | Recombinant Full Length Human DDX60 Protein, GST-tagged | +Inquiry |
| DDX60-775H | Recombinant Human DDX60 protein, His-SUMO-tagged | +Inquiry |
| DDX60-776H | Recombinant Human DDX60 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DDX60 Products
Required fields are marked with *
My Review for All DDX60 Products
Required fields are marked with *
