Recombinant Human DDX60 protein, His-tagged
Cat.No. : | DDX60-425H |
Product Overview : | Recombinant Human DDX60 protein(NP_060101.3)(1363-1712 aa), fused to His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1363-1712 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | PLSITLVLRLMLLASKGDDPEDTKAKVLSVLKHSLLSFKQPRVMDMLKLYFLFSLQFLVKEGYLDQEGNPMGFAGLVSHLHYHEPSNLVFVSFLVNGLFHDLCQPTRKGSKHFSQDVMEKLVLVLAHLFGRRYFPPKFQDAHFEFYQSKVFLDDLPEDFSDALDEYNMKIMEDFTTFLRIVSKLADMNQEYQLPLSKIKFTGKECEDSQLVSHLMSCKEGRVAISPFVCLSGNFDDDLLRLETPNHVTLGTIGVNRSQAPVLLSQKFDNRGRKMSLNAYALDFYKHGSLIGLVQDNRMNEGDAYYLLKDFALTIKSISVSLRELCENEDDNVVLAFEQLSTTFWEKLNKV |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | DDX60 DEAD (Asp-Glu-Ala-Asp) box polypeptide 60 [ Homo sapiens ] |
Official Symbol | DDX60 |
Gene ID | 55601 |
mRNA Refseq | NM_017631.5 |
Protein Refseq | NP_060101.3 |
MIM | 613974 |
UniProt ID | Q8IY21 |
◆ Recombinant Proteins | ||
DDX60-776H | Recombinant Human DDX60 protein, His-tagged | +Inquiry |
DDX60-4253H | Recombinant Human DDX60 Protein, GST-tagged | +Inquiry |
DDX60-3433H | Recombinant Human DDX60 protein, His&Myc-tagged | +Inquiry |
DDX60-4879HF | Recombinant Full Length Human DDX60 Protein, GST-tagged | +Inquiry |
DDX60-775H | Recombinant Human DDX60 protein, His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DDX60 Products
Required fields are marked with *
My Review for All DDX60 Products
Required fields are marked with *