Recombinant Full Length Human DDX60 Protein, GST-tagged
| Cat.No. : | DDX60-4879HF |
| Product Overview : | Human FLJ20035 full-length ORF ( AAH20601.1, 1 a.a. - 183 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 183 amino acids |
| Description : | DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases which are implicated in a number of cellular procsses involving RNA binding and alteration of RNA secondary structure. This gene encodes a DEXD/H box RNA helicase that functions as an antiviral factor and promotes RIG-I-like receptor-mediated signaling. [provided by RefSeq, Apr 2017] |
| Molecular Mass : | 47.2 kDa |
| AA Sequence : | MKIMEDFTTFLRIVSKLADMNQEYQLPLSKIKFTGKECEDSQLVSHLMSCKEGRVAISPFVCLSGNFDDDLLRLETPNHVTLGTIGVNRSQAPVLLSQKFDNRGRKMSLNAYALDFYKHGSLIGLVQDNRMNEGDAYYLLKDFALTIKSISVSLRELCENEDDNVVLAFEQLSTTFWEKLNKV |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DDX60 DEAD (Asp-Glu-Ala-Asp) box polypeptide 60 [ Homo sapiens ] |
| Official Symbol | DDX60 |
| Synonyms | DExD/H-Box Helicase 60; DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 60; DEAD Box Protein 60; EC 3.6.4.13; DDX60; DEAD (Asp-Glu-Ala-Asp) box polypeptide 60 |
| Gene ID | 55601 |
| mRNA Refseq | NM_017631 |
| Protein Refseq | NP_060101 |
| MIM | 613974 |
| UniProt ID | Q8IY21 |
| ◆ Recombinant Proteins | ||
| DDX60-425H | Recombinant Human DDX60 protein, His-tagged | +Inquiry |
| DDX60-4879HF | Recombinant Full Length Human DDX60 Protein, GST-tagged | +Inquiry |
| DDX60-4253H | Recombinant Human DDX60 Protein, GST-tagged | +Inquiry |
| DDX60-775H | Recombinant Human DDX60 protein, His-SUMO-tagged | +Inquiry |
| DDX60-3433H | Recombinant Human DDX60 protein, His&Myc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DDX60 Products
Required fields are marked with *
My Review for All DDX60 Products
Required fields are marked with *
