Recombinant Human DECR1, His-tagged

Cat.No. : DECR1-972H
Product Overview : Recombinanthuman DECR1 with his tag was expressed in E.coli and purified by conventional chromatography, 34.4 kDa(35 a.a. - 335 a.a.).
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 35-335 a.a.
Description : This geneencodes an accessory enzyme which participates in the beta-oxidation andmetabolism of unsaturated fatty enoyl-CoA esters.
Amino Acid Sequence : MGSSHHHHHHSSGLVPRGSHMNTEALQSKFFSPLQKAMLPPNSFQGKVAFITGGGTGLGKGMTTLLSSLGAQCVIASRKMDVLKATAEQISSQTGNK VHAIQCDVRDPDMVQNTVSELIKVAGHPNIVINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLIKAQKGAAFLSITTIYAETGSGFVVPSASAK AGVEAMSKSLAAEWGKYGMRFNVIQPGPIKTKGAFSRLDPTGTFEKEMIGRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGGEEVLISGEFNDL RKVTKEQWDTIEELIRKTKGS
Form : Liquid
Concentration : 1 mg/mL
Purity : > 90% by SDS-PAGE
Applications : SDS-PAGE
StorageBuffer : In 20 mM Tris-HCl, pH 8.0(10% glycerol, 1 mMdithiothreitol)
Storage : Store at4°C for 1-2 weeks. For long term storage store at -20°C or -80°C. Aliquot toavoid repeated freezing and thawing.
OfficialSymbol : DECR1
Gene Name DECR1 2,4-dienoyl CoA reductase1, mitochondrial [Homo sapiens]
Synonyms DECR1; DECR; NADPH;SDR18C1; 2,4-dienoyl CoA reductase 1, mitochondrial; 2,4-dienoyl-CoAreductase, mitochondrial;4-enoyl-CoA reductase;short chaindehydrogenase/reductase family 18C, member 1; 4-enoyl-CoA reductase [NADPH];EC1.3.1.34; 2,4-dienoyl-CoA reductase [NADPH]
Gene ID 1666
mRNA Refseq NM_001359
Protein Refseq NP_001350
MIM 222745
UniProt ID Q16698
Chromosome Location 8q21.3
Pathway Fatty Acid BetaOxidation; Fatty Acid Biosynthesis; Fatty acid
Function 2,4-dienoyl-CoA reductase (NADPH) activity; NADPH binding; nucleotidebinding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DECR1 Products

Required fields are marked with *

My Review for All DECR1 Products

Required fields are marked with *

0
cart-icon