Recombinant Human DECR1, His-tagged
| Cat.No. : | DECR1-972H |
| Product Overview : | Recombinanthuman DECR1 with his tag was expressed in E.coli and purified by conventional chromatography, 34.4 kDa(35 a.a. - 335 a.a.). |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 35-335 a.a. |
| Description : | This geneencodes an accessory enzyme which participates in the beta-oxidation andmetabolism of unsaturated fatty enoyl-CoA esters. |
| Amino Acid Sequence : | MGSSHHHHHHSSGLVPRGSHMNTEALQSKFFSPLQKAMLPPNSFQGKVAFITGGGTGLGKGMTTLLSSLGAQCVIASRKMDVLKATAEQISSQTGNK VHAIQCDVRDPDMVQNTVSELIKVAGHPNIVINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLIKAQKGAAFLSITTIYAETGSGFVVPSASAK AGVEAMSKSLAAEWGKYGMRFNVIQPGPIKTKGAFSRLDPTGTFEKEMIGRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGGEEVLISGEFNDL RKVTKEQWDTIEELIRKTKGS |
| Form : | Liquid |
| Concentration : | 1 mg/mL |
| Purity : | > 90% by SDS-PAGE |
| Applications : | SDS-PAGE |
| StorageBuffer : | In 20 mM Tris-HCl, pH 8.0(10% glycerol, 1 mMdithiothreitol) |
| Storage : | Store at4°C for 1-2 weeks. For long term storage store at -20°C or -80°C. Aliquot toavoid repeated freezing and thawing. |
| OfficialSymbol : | DECR1 |
| Gene Name | DECR1 2,4-dienoyl CoA reductase1, mitochondrial [Homo sapiens] |
| Synonyms | DECR1; DECR; NADPH;SDR18C1; 2,4-dienoyl CoA reductase 1, mitochondrial; 2,4-dienoyl-CoAreductase, mitochondrial;4-enoyl-CoA reductase;short chaindehydrogenase/reductase family 18C, member 1; 4-enoyl-CoA reductase [NADPH];EC1.3.1.34; 2,4-dienoyl-CoA reductase [NADPH] |
| Gene ID | 1666 |
| mRNA Refseq | NM_001359 |
| Protein Refseq | NP_001350 |
| MIM | 222745 |
| UniProt ID | Q16698 |
| Chromosome Location | 8q21.3 |
| Pathway | Fatty Acid BetaOxidation; Fatty Acid Biosynthesis; Fatty acid |
| Function | 2,4-dienoyl-CoA reductase (NADPH) activity; NADPH binding; nucleotidebinding |
| ◆ Recombinant Proteins | ||
| DECR1-205C | Recombinant Cynomolgus Monkey DECR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| DECR1-971H | Recombinant Human 2,4-Dienoyl-CoA Reductase, Mitochondrial, His-tagged | +Inquiry |
| DECR1-26259TH | Recombinant Human DECR1, His-tagged | +Inquiry |
| DECR1-972H | Recombinant Human DECR1, His-tagged | +Inquiry |
| DECR1-733H | Recombinant Human DECR1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DECR1-6997HCL | Recombinant Human DECR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DECR1 Products
Required fields are marked with *
My Review for All DECR1 Products
Required fields are marked with *
