Recombinant Human DEF8 Protein, GST-tagged
Cat.No. : | DEF8-2517H |
Product Overview : | Human DEF8 full-length ORF ( ADR82741.1, 1 a.a. - 197 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | DEF8 (Differentially Expressed In FDCP 8 Homolog) is a Protein Coding gene. An important paralog of this gene is PLEKHM1. |
Molecular Mass : | 21.7 kDa |
AA Sequence : | MEYDEKLARFRQAHLNPFNKQSGPRQHEQGPGEEVPDVTPEEALPELPPGEPEFRCPERVMDLGLSEDHFSRPVGLFLASDVQQLRQAIEECKQVILELPEQSEKQKDAVVRLIHLRLKLQELKDPNEDEPNIRVLLEHRFYKEKSKSVKQTCDKCNTIIWGLIQTWYTCTGGPRPRRGVRNERDQSSCLRWAHIQM |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DEF8 differentially expressed in FDCP 8 homolog (mouse) [ Homo sapiens ] |
Official Symbol | DEF8 |
Synonyms | DEF8; differentially expressed in FDCP 8 homolog (mouse); differentially expressed in FDCP 8 homolog; FLJ20186; DEF-8; MGC104349; |
Gene ID | 54849 |
mRNA Refseq | NM_001242816 |
Protein Refseq | NP_001229745 |
UniProt ID | Q6ZN54 |
◆ Recombinant Proteins | ||
DEF8-2517H | Recombinant Human DEF8 Protein, GST-tagged | +Inquiry |
DEF8-1828R | Recombinant Rat DEF8 Protein | +Inquiry |
DEF8-1486R | Recombinant Rat DEF8 Protein, His (Fc)-Avi-tagged | +Inquiry |
DEF8-483H | Recombinant Human DEF8 Protein, His-tagged | +Inquiry |
DEF8-2423HF | Recombinant Full Length Human DEF8 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DEF8-6992HCL | Recombinant Human DEF8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DEF8 Products
Required fields are marked with *
My Review for All DEF8 Products
Required fields are marked with *
0
Inquiry Basket