"DEF8" Related Products

Expand

Recombinant Human DEF8 Protein, GST-tagged

Cat.No.: DEF8-2517H
Product Overview: Human DEF8 full-length ORF ( ADR82741.1, 1 a.a. - 197 a.a.) recombinant protein with GST-tag at N-terminal.
Description: DEF8 (Differentially Expressed In FDCP 8 Homolog) is a Protein Coding gene. An important paralog of this gene is PLEKHM1.
Source: Wheat Germ
Species: Human
Tag : GST
Molecular Mass: 21.7 kDa
AA Sequence: MEYDEKLARFRQAHLNPFNKQSGPRQHEQGPGEEVPDVTPEEALPELPPGEPEFRCPERVMDLGLSEDHFSRPVGLFLASDVQQLRQAIEECKQVILELPEQSEKQKDAVVRLIHLRLKLQELKDPNEDEPNIRVLLEHRFYKEKSKSVKQTCDKCNTIIWGLIQTWYTCTGGPRPRRGVRNERDQSSCLRWAHIQM
Applications: Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: DEF8 differentially expressed in FDCP 8 homolog (mouse) [ Homo sapiens ]
Official Symbol: DEF8
Synonyms: DEF8; differentially expressed in FDCP 8 homolog (mouse); differentially expressed in FDCP 8 homolog; FLJ20186; DEF-8; MGC104349;
Gene ID: 54849
mRNA Refseq: NM_001242816
Protein Refseq: NP_001229745
UniProt ID: Q6ZN54

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.