Recombinant Human DEFA4 Protein, His tagged

• Cat.No.: DEFA4-002H
• Product Overview: Recombinant Human DEFA4 Protein (20-97 aa) with His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 20-97 aa
• Description: Defensins are a family of antimicrobial and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. Several alpha defensin genes are clustered on chromosome 8. This gene differs from other genes of this family by an extra 83-base segment that is apparently the result of a recent duplication within the coding region. The protein encoded by this gene, defensin, alpha 4, is found in the neutrophils; it exhibits corticostatic activity and inhibits corticotropin stimulated corticosterone production.
• Form: Sterile PBS, pH7.4, 0.1% SKL
• Molecular Mass: 10 kDa
• AASequence: MGPLQARGDEAPGQEQRGPEDQDISISFAWDKSSALQVSGSTRGMVCSCRLVFCRRTELRVGNCLIGGVSFTYCCTRVDHHHHHHHHHH
• Endotoxin: < 1 EU/μg by LAL
• Purity: > 90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 1 mg/mL by BCA

Gene Information

• Gene Name: DEFA4 defensin alpha 4 [ Homo sapiens (human) ]
• Official Symbol: DEFA4
• Synonyms: DEFA4; defensin alpha 4; HP4; DEF4; HP-4; HNP-4; defensin alpha 4; corticostatin; corticostatin HP-4; defensin, alpha 4, corticostatin; defensin, alpha 4, preproprotein; neutrophil defensin 4
• Gene ID: 1669
• mRNA Refseq: NM_001925
• Protein Refseq: NP_001916
• MIM: 601157
• UniProt ID: P12838