Recombinant Human DEFB109 Protein, GST-tagged

Cat.No. : DEFB109-2523H
Product Overview : Human DEFB109 full-length ORF ( AAI48782.1, 1 a.a. - 87 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : DEFB109C (Defensin Beta 109C) is an Uncategorized gene.
Molecular Mass : 36.52 kDa
AA Sequence : MRLHLLLLILLLFSILLSPVRGGLGPAEGHCLNLFGVCRTDVCNIVEDQIGACRRRMKCCRAWWILMPIPTPLIMSDYQEPLKPNLK
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DEFB109 defensin, beta 109 [ Homo sapiens ]
Official Symbol DEFB109
Synonyms DEFB109; defensin, beta 109;
Gene ID 100286963

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DEFB109 Products

Required fields are marked with *

My Review for All DEFB109 Products

Required fields are marked with *

0
cart-icon