Recombinant Human DEFB113 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: DEFB113-5939H
• Product Overview: DEFB113 MS Standard C13 and N15-labeled recombinant protein (NP_001032818) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Defensins form a family of antimicrobial and cytotoxic peptides made by neutrophils. Defensins are short, processed peptide molecules that are classified by structure into three groups: alpha-defensins, beta-defensins and theta-defensins. All beta-defensin genes are densely clustered in four to five syntenic chromosomal regions.
• Molecular Mass: 9.5 kDa
• AA Sequence: MKILCIFLTFVFTVSCGPSVPQKKTREVAERKRECQLVRGACKPECNSWEYVYYYCNVNPCCAVWEYQKPIINKITSKLHQKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: DEFB113 defensin beta 113 [ Homo sapiens (human) ]
• Official Symbol: DEFB113
• Synonyms: DEFB113; defensin beta 113; DEFB-13; beta-defensin 113; beta-defensin 13; defensin, beta 13
• Gene ID: 245927
• mRNA Refseq: NM_001037729
• Protein Refseq: NP_001032818
• UniProt ID: Q30KQ7