Recombinant Human DEFB113 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : DEFB113-5939H
Product Overview : DEFB113 MS Standard C13 and N15-labeled recombinant protein (NP_001032818) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Defensins form a family of antimicrobial and cytotoxic peptides made by neutrophils. Defensins are short, processed peptide molecules that are classified by structure into three groups: alpha-defensins, beta-defensins and theta-defensins. All beta-defensin genes are densely clustered in four to five syntenic chromosomal regions.
Molecular Mass : 9.5 kDa
AA Sequence : MKILCIFLTFVFTVSCGPSVPQKKTREVAERKRECQLVRGACKPECNSWEYVYYYCNVNPCCAVWEYQKPIINKITSKLHQKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name DEFB113 defensin beta 113 [ Homo sapiens (human) ]
Official Symbol DEFB113
Synonyms DEFB113; defensin beta 113; DEFB-13; beta-defensin 113; beta-defensin 13; defensin, beta 13
Gene ID 245927
mRNA Refseq NM_001037729
Protein Refseq NP_001032818
UniProt ID Q30KQ7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DEFB113 Products

Required fields are marked with *

My Review for All DEFB113 Products

Required fields are marked with *

0
cart-icon
0
compare icon