Recombinant Human DEFB118 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | DEFB118-6030H |
Product Overview : | DEFB118 MS Standard C13 and N15-labeled recombinant protein (NP_473453) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the beta subfamily of defensins. Beta-defensins are antimicrobial peptides that protect tissues and organs from infection by a variety of microorganisms. Expression of this gene is regulated by androgen, and the encoded protein binds to sperm and exhibits antibacterial activity against E. coli. This gene is found in a cluster with other beta-defensin genes on the long arm of chromosome 20. |
Molecular Mass : | 13.6 kDa |
AA Sequence : | MKLLLLALPMLVLLPQVIPAYSGEKKCWNRSGHCRKQCKDGEAVKDTCKNLRACCIPSNEDHRRVPATSPTPLSDSTPGIIDDILTVRFTTDYFEVSSKKDMVEESEAGRGTETSLPNVHHSSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | DEFB118 defensin beta 118 [ Homo sapiens (human) ] |
Official Symbol | DEFB118 |
Synonyms | DEFB118; defensin, beta 118; ESC42; DEFB-18; ESP13.6; C20orf63; beta-defensin 118; defensin, beta 18; epididymal secretory protein 13.6; epididymis secretory sperm binding protein; epididymus specific clone 42 |
Gene ID | 117285 |
mRNA Refseq | NM_054112 |
Protein Refseq | NP_473453 |
MIM | 607650 |
UniProt ID | Q96PH6 |
◆ Recombinant Proteins | ||
DEFB118-1056R | Recombinant Rhesus Macaque DEFB118 Protein, His (Fc)-Avi-tagged | +Inquiry |
DEFB118-6030H | Recombinant Human DEFB118 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DEFB118-2453H | Recombinant human DEFB118, His-tagged | +Inquiry |
DEFB118-1231R | Recombinant Rhesus monkey DEFB118 Protein, His-tagged | +Inquiry |
DEFB118-442H | Recombinant Human DEFB118 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DEFB118-6986HCL | Recombinant Human DEFB118 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DEFB118 Products
Required fields are marked with *
My Review for All DEFB118 Products
Required fields are marked with *