Recombinant Human DEFB118 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : DEFB118-6030H
Product Overview : DEFB118 MS Standard C13 and N15-labeled recombinant protein (NP_473453) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of the beta subfamily of defensins. Beta-defensins are antimicrobial peptides that protect tissues and organs from infection by a variety of microorganisms. Expression of this gene is regulated by androgen, and the encoded protein binds to sperm and exhibits antibacterial activity against E. coli. This gene is found in a cluster with other beta-defensin genes on the long arm of chromosome 20.
Molecular Mass : 13.6 kDa
AA Sequence : MKLLLLALPMLVLLPQVIPAYSGEKKCWNRSGHCRKQCKDGEAVKDTCKNLRACCIPSNEDHRRVPATSPTPLSDSTPGIIDDILTVRFTTDYFEVSSKKDMVEESEAGRGTETSLPNVHHSSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name DEFB118 defensin beta 118 [ Homo sapiens (human) ]
Official Symbol DEFB118
Synonyms DEFB118; defensin, beta 118; ESC42; DEFB-18; ESP13.6; C20orf63; beta-defensin 118; defensin, beta 18; epididymal secretory protein 13.6; epididymis secretory sperm binding protein; epididymus specific clone 42
Gene ID 117285
mRNA Refseq NM_054112
Protein Refseq NP_473453
MIM 607650
UniProt ID Q96PH6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DEFB118 Products

Required fields are marked with *

My Review for All DEFB118 Products

Required fields are marked with *

0
cart-icon