Recombinant Human DEFB124 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | DEFB124-4857H |
Product Overview : | DEFB124 MS Standard C13 and N15-labeled recombinant protein (NP_001032589) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Defensins are cysteine-rich cationic polypeptides that are important in the host immunologic response to invading microorganisms. This antimicrobial protein is secreted and is a member of the beta defensin protein family. Beta defensin genes are found in several clusters throughout the genome, with this gene mapping to a cluster at 20q11.1. The encoded protein may serve to enhance innate immunity in the prostate. |
Molecular Mass : | 7.9 kDa |
AA Sequence : | MTQLLLFLVALLVLGHVPSGRSEFKRCWKGQGACQTYCTRQETYMHLCPDASLCCLSYALKPPPVPKHEYETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | DEFB124 defensin beta 124 [ Homo sapiens (human) ] |
Official Symbol | DEFB124 |
Synonyms | DEFB124; defensin beta 124; DEFB-24; beta-defensin 124; beta-defensin 24; defensin, beta 24 |
Gene ID | 245937 |
mRNA Refseq | NM_001037500 |
Protein Refseq | NP_001032589 |
UniProt ID | Q8NES8 |
◆ Recombinant Proteins | ||
DEFB124-1078H | Recombinant Human DEFB124 Protein (23-71 aa), His-SUMO-tagged | +Inquiry |
DEFB124-1061R | Recombinant Rhesus Macaque DEFB124 Protein, His (Fc)-Avi-tagged | +Inquiry |
DEFB124-4857H | Recombinant Human DEFB124 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DEFB124-1236R | Recombinant Rhesus monkey DEFB124 Protein, His-tagged | +Inquiry |
DEFB124-453H | Recombinant Human DEFB124 Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DEFB124 Products
Required fields are marked with *
My Review for All DEFB124 Products
Required fields are marked with *