Recombinant Human DEFB124 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : DEFB124-4857H
Product Overview : DEFB124 MS Standard C13 and N15-labeled recombinant protein (NP_001032589) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Defensins are cysteine-rich cationic polypeptides that are important in the host immunologic response to invading microorganisms. This antimicrobial protein is secreted and is a member of the beta defensin protein family. Beta defensin genes are found in several clusters throughout the genome, with this gene mapping to a cluster at 20q11.1. The encoded protein may serve to enhance innate immunity in the prostate.
Molecular Mass : 7.9 kDa
AA Sequence : MTQLLLFLVALLVLGHVPSGRSEFKRCWKGQGACQTYCTRQETYMHLCPDASLCCLSYALKPPPVPKHEYETRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name DEFB124 defensin beta 124 [ Homo sapiens (human) ]
Official Symbol DEFB124
Synonyms DEFB124; defensin beta 124; DEFB-24; beta-defensin 124; beta-defensin 24; defensin, beta 24
Gene ID 245937
mRNA Refseq NM_001037500
Protein Refseq NP_001032589
UniProt ID Q8NES8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DEFB124 Products

Required fields are marked with *

My Review for All DEFB124 Products

Required fields are marked with *

0
cart-icon