Recombinant Human DEFB131A Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : DEFB131A-5557H
Product Overview : DEFB131 MS Standard C13 and N15-labeled recombinant protein (NP_001035538) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Defensins are cysteine-rich cationic polypeptides that are important in the immunologic response to invading microorganisms. The antimicrobial protein encoded by this gene is secreted and is a member of the beta defensin protein family. Beta defensin genes are found in several clusters throughout the genome, with this gene mapping to a cluster at 4p16.
Molecular Mass : 8 kDa
AA Sequence : MRVLFFVFGVLSLMFTVPPGRSFISNDECPSEYYHCRLKCNADEHAIRYCADFSICCKLKIIEIDGQKKWTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name DEFB131A defensin beta 131A [ Homo sapiens (human) ]
Official Symbol DEFB131A
Synonyms DEFB131A; defensin beta 131A; DEFB-31; DEFB131; beta-defensin 131A; beta-defensin 131; beta-defensin 31; defensin beta 131; defensin, beta 31
Gene ID 644414
mRNA Refseq NM_001040448
Protein Refseq NP_001035538
UniProt ID P59861

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DEFB131A Products

Required fields are marked with *

My Review for All DEFB131A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon