Recombinant Human DEFB131A Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | DEFB131A-5557H |
| Product Overview : | DEFB131 MS Standard C13 and N15-labeled recombinant protein (NP_001035538) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Defensins are cysteine-rich cationic polypeptides that are important in the immunologic response to invading microorganisms. The antimicrobial protein encoded by this gene is secreted and is a member of the beta defensin protein family. Beta defensin genes are found in several clusters throughout the genome, with this gene mapping to a cluster at 4p16. |
| Molecular Mass : | 8 kDa |
| AA Sequence : | MRVLFFVFGVLSLMFTVPPGRSFISNDECPSEYYHCRLKCNADEHAIRYCADFSICCKLKIIEIDGQKKWTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | DEFB131A defensin beta 131A [ Homo sapiens (human) ] |
| Official Symbol | DEFB131A |
| Synonyms | DEFB131A; defensin beta 131A; DEFB-31; DEFB131; beta-defensin 131A; beta-defensin 131; beta-defensin 31; defensin beta 131; defensin, beta 31 |
| Gene ID | 644414 |
| mRNA Refseq | NM_001040448 |
| Protein Refseq | NP_001035538 |
| UniProt ID | P59861 |
| ◆ Recombinant Proteins | ||
| DEFB131A-5557H | Recombinant Human DEFB131A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DEFB131A Products
Required fields are marked with *
My Review for All DEFB131A Products
Required fields are marked with *



