Recombinant Human DENND5A protein, His-tagged
Cat.No. : | DENND5A-3686H |
Product Overview : | Recombinant Human DENND5A protein(1-60 aa), fused to His tag, was expressed in E. coli. |
Availability | July 01, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-60 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MSGGGGGGGSAPSRFADYFVICGLDTETGLEPDELSALCQYIQASKARDGASPFISSTTE |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | DENND5A DENN/MADD domain containing 5A [ Homo sapiens ] |
Official Symbol | DENND5A |
Synonyms | DENND5A; DENN/MADD domain containing 5A; RAB6 interacting protein 1 , RAB6IP1; DENN domain-containing protein 5A; FLJ22354; FLJ33829; FLJ43455; KIAA1091; RAB6 interacting protein 1; rab6-interacting protein 1; RAB6IP1; |
Gene ID | 23258 |
mRNA Refseq | NM_001243254 |
Protein Refseq | NP_001230183 |
UniProt ID | Q6IQ26 |
◆ Recombinant Proteins | ||
DENND5A-4514M | Recombinant Mouse DENND5A Protein | +Inquiry |
DENND5A-3686H | Recombinant Human DENND5A protein, His-tagged | +Inquiry |
DENND5A-1423H | Recombinant Human DENND5A | +Inquiry |
DENND5A-2787H | Recombinant Human DENND5A Protein, His (Fc)-Avi-tagged | +Inquiry |
DENND5A-2330M | Recombinant Mouse DENND5A Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DENND5A-1456HCL | Recombinant Human DENND5A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DENND5A Products
Required fields are marked with *
My Review for All DENND5A Products
Required fields are marked with *