| Species : |
Human |
| Source : |
E.coli |
| Tag : |
His |
| Protein Length : |
1-198 a.a. |
| Description : |
This gene encodes a protein whose expression was found to increase in cultured cells at high density but not during growth arrest. This gene was also shown to have increased expression in cells overexpressing HER-2/neu proto-oncogene. The protein contains an SUI1 domain. In budding yeast, SUI1 is a translation initiation factor that along with eIF-2 and the initiator tRNA-Met, directs the ribosome to the proper translation start site. Proteins similar to SUI have been found in mammals, insects, and plants. |
| Conjugation : |
HIS |
| Tissue specificity : |
Highly expressed in heart and skeletal muscle and moderately expressed in the brain, placenta, liver and pancreas. Weakly expressed in the lung and kidney. |
| Form : |
Lyophilised:Reconstitute with 96 μl aqua dest. |
| Storage buffer : |
Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : |
Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : |
MAADISESSGADCKGDPRNSAKLDADYPLRVLYCGVCSLP TEYCEYMPDVAKCRQWLEKNFPNEFAKLTVENSPKQEA GISEGQGTAGEEEEKKKQKRGGRGQIKQKKKTVPQKVT IAKIPRAKKKYVTRVCGLATFEIDLKEAQRFFAQKFSC GASVTGEDEIIIQGDFTDDIIDVIQEKWPEVDDDSIEDLGEVKK |
| Sequence Similarities : |
Belongs to the DENR family.Contains 1 SUI1 domain. |
| Full Length : |
Full L. |