Recombinant Human DERL2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | DERL2-2389H |
Product Overview : | DERL2 MS Standard C13 and N15-labeled recombinant protein (NP_057125) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Proteins that are unfolded or misfolded in the endoplasmic reticulum (ER) must be refolded or degraded to maintain the homeostasis of the ER. DERL2 is involved in the degradation of misfolded glycoproteins in the ER. |
Molecular Mass : | 27.6 kDa |
AA Sequence : | MAYQSLRLEYLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITNFLFFGPVGFNFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFVSLVFLGQAFTIMLVYVWSRRNPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFFLEDVFPNQPGGIRILKTPSILKAIFDTPDEDPNYNPLPEERPGGFAWGEGQRLGGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | DERL2 derlin 2 [ Homo sapiens (human) ] |
Official Symbol | DERL2 |
Synonyms | DERL2; Der1-like domain family, member 2; derlin-2; CGI 101; derlin 2; F LAN 1; F LANa; FLANa; DERtrin-2; carcinoma related; der1-like protein 2; degradation in endoplasmic reticulum protein 2; F-LANa; CGI-101; F-LAN-1; |
Gene ID | 51009 |
mRNA Refseq | NM_016041 |
Protein Refseq | NP_057125 |
MIM | 610304 |
UniProt ID | Q9GZP9 |
◆ Recombinant Proteins | ||
DERL2-984H | Recombinant Human DERL2 | +Inquiry |
DERL2-1245R | Recombinant Rhesus monkey DERL2 Protein, His-tagged | +Inquiry |
RFL31419DF | Recombinant Full Length Dictyostelium Discoideum Probable Derlin-2 Homolog(Derl2) Protein, His-Tagged | +Inquiry |
DERL2-2791H | Recombinant Human DERL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
DERL2-1070R | Recombinant Rhesus Macaque DERL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DERL2-6970HCL | Recombinant Human DERL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DERL2 Products
Required fields are marked with *
My Review for All DERL2 Products
Required fields are marked with *
0
Inquiry Basket