Recombinant Human DERL2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : DERL2-2389H
Product Overview : DERL2 MS Standard C13 and N15-labeled recombinant protein (NP_057125) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Proteins that are unfolded or misfolded in the endoplasmic reticulum (ER) must be refolded or degraded to maintain the homeostasis of the ER. DERL2 is involved in the degradation of misfolded glycoproteins in the ER.
Molecular Mass : 27.6 kDa
AA Sequence : MAYQSLRLEYLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITNFLFFGPVGFNFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFVSLVFLGQAFTIMLVYVWSRRNPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFFLEDVFPNQPGGIRILKTPSILKAIFDTPDEDPNYNPLPEERPGGFAWGEGQRLGGTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name DERL2 derlin 2 [ Homo sapiens (human) ]
Official Symbol DERL2
Synonyms DERL2; Der1-like domain family, member 2; derlin-2; CGI 101; derlin 2; F LAN 1; F LANa; FLANa; DERtrin-2; carcinoma related; der1-like protein 2; degradation in endoplasmic reticulum protein 2; F-LANa; CGI-101; F-LAN-1;
Gene ID 51009
mRNA Refseq NM_016041
Protein Refseq NP_057125
MIM 610304
UniProt ID Q9GZP9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DERL2 Products

Required fields are marked with *

My Review for All DERL2 Products

Required fields are marked with *

0
cart-icon
0
compare icon