Recombinant Human DESI1 Protein, GST-tagged
Cat.No. : | DESI1-5155H |
Product Overview : | Human D15Wsu75e full-length ORF ( NP_056519.1, 1 a.a. - 168 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | DESI1 (Desumoylating Isopeptidase 1) is a Protein Coding gene. GO annotations related to this gene include identical protein binding and peptidase activity. |
Molecular Mass : | 44.7 kDa |
AA Sequence : | MEPPNLYPVKLYVYDLSKGLARRLSPIMLGKQLEGIWHTSIVVHKDEFFFGSGGISSCPPGGTLLGPPDSVVDVGSTEVTEEIFLEYLSSLGESLFRGEAYNLFEHNCNTFSNEVAQFLTGRKIPSYITDLPSEVLSTPFGQALRPLLDSIQIQPPGGSSVGRPNGQS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DESI1 desumoylating isopeptidase 1 [ Homo sapiens (human) ] |
Official Symbol | DESI1 |
Synonyms | FAM152B; DESI1; desumoylating isopeptidase 1; DESI2; DeSI-1; PPPDE2; FAM152B; D15Wsu75e; DJ347H13.4; desumoylating isopeptidase 1; PPPDE peptidase domain containing 2; PPPDE peptidase domain-containing protein 2; desumoylating isopeptidase 2; family with sequence similarity 152, member B |
Gene ID | 27351 |
mRNA Refseq | NM_015704 |
Protein Refseq | NP_056519 |
MIM | 614637 |
UniProt ID | Q6ICB0 |
◆ Recombinant Proteins | ||
DESI1-1245H | Recombinant Human DESI1 | +Inquiry |
DESI1-3789HF | Recombinant Full Length Human DESI1 Protein, GST-tagged | +Inquiry |
DESI1-6133H | Recombinant Human DESI1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DESI1-5155H | Recombinant Human DESI1 Protein, GST-tagged | +Inquiry |
DESI1-2793H | Recombinant Human DESI1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DESI1 Products
Required fields are marked with *
My Review for All DESI1 Products
Required fields are marked with *