Recombinant Human DESI1 Protein, GST-tagged

Cat.No. : DESI1-5155H
Product Overview : Human D15Wsu75e full-length ORF ( NP_056519.1, 1 a.a. - 168 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : DESI1 (Desumoylating Isopeptidase 1) is a Protein Coding gene. GO annotations related to this gene include identical protein binding and peptidase activity.
Molecular Mass : 44.7 kDa
AA Sequence : MEPPNLYPVKLYVYDLSKGLARRLSPIMLGKQLEGIWHTSIVVHKDEFFFGSGGISSCPPGGTLLGPPDSVVDVGSTEVTEEIFLEYLSSLGESLFRGEAYNLFEHNCNTFSNEVAQFLTGRKIPSYITDLPSEVLSTPFGQALRPLLDSIQIQPPGGSSVGRPNGQS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DESI1 desumoylating isopeptidase 1 [ Homo sapiens (human) ]
Official Symbol DESI1
Synonyms FAM152B; DESI1; desumoylating isopeptidase 1; DESI2; DeSI-1; PPPDE2; FAM152B; D15Wsu75e; DJ347H13.4; desumoylating isopeptidase 1; PPPDE peptidase domain containing 2; PPPDE peptidase domain-containing protein 2; desumoylating isopeptidase 2; family with sequence similarity 152, member B
Gene ID 27351
mRNA Refseq NM_015704
Protein Refseq NP_056519
MIM 614637
UniProt ID Q6ICB0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DESI1 Products

Required fields are marked with *

My Review for All DESI1 Products

Required fields are marked with *

0
cart-icon