Recombinant Human DESI1 Protein, GST-tagged

• Cat.No.: DESI1-5155H
• Product Overview: Human D15Wsu75e full-length ORF ( NP_056519.1, 1 a.a. - 168 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: DESI1 (Desumoylating Isopeptidase 1) is a Protein Coding gene. GO annotations related to this gene include identical protein binding and peptidase activity.
• Molecular Mass: 44.7 kDa
• AA Sequence: MEPPNLYPVKLYVYDLSKGLARRLSPIMLGKQLEGIWHTSIVVHKDEFFFGSGGISSCPPGGTLLGPPDSVVDVGSTEVTEEIFLEYLSSLGESLFRGEAYNLFEHNCNTFSNEVAQFLTGRKIPSYITDLPSEVLSTPFGQALRPLLDSIQIQPPGGSSVGRPNGQS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DESI1 desumoylating isopeptidase 1 [ Homo sapiens (human) ]
• Official Symbol: DESI1
• Synonyms: FAM152B; DESI1; desumoylating isopeptidase 1; DESI2; DeSI-1; PPPDE2; FAM152B; D15Wsu75e; DJ347H13.4; desumoylating isopeptidase 1; PPPDE peptidase domain containing 2; PPPDE peptidase domain-containing protein 2; desumoylating isopeptidase 2; family with sequence similarity 152, member B
• Gene ID: 27351
• mRNA Refseq: NM_015704
• Protein Refseq: NP_056519
• MIM: 614637
• UniProt ID: Q6ICB0