Recombinant Human DFNB31 Protein, GST-tagged
| Cat.No. : | DFNB31-2561H |
| Product Overview : | Human DFNB31 partial ORF ( NP_056219, 808 a.a. - 907 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene is thought to function in the organization and stabilization of sterocilia elongation and actin cystoskeletal assembly, based on studies of the related mouse gene. Mutations in this gene have been associated with autosomal recessive non-syndromic deafness and Usher Syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2016] |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | GLLEPTSTLVRVKKSAATLGIAIEGGANTRQPLPRIVTIQRGGSAHNCGQLKVGHVILEVNGLTLRGKEHREAARIIAEAFKTKDRDYIDFLVTEFNVML |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DFNB31 deafness, autosomal recessive 31 [ Homo sapiens ] |
| Official Symbol | DFNB31 |
| Synonyms | DFNB31; deafness, autosomal recessive 31; whirlin; CIP98; USH2D; WHRN; CASK-interacting protein CIP98; autosomal recessive deafness type 31 protein; WI; RP11-9M16.1; KIAA1526; DKFZp434N014; |
| Gene ID | 25861 |
| mRNA Refseq | NM_001083885 |
| Protein Refseq | NP_001077354 |
| MIM | 607928 |
| UniProt ID | Q9P202 |
| ◆ Recombinant Proteins | ||
| DFNB31-2561H | Recombinant Human DFNB31 Protein, GST-tagged | +Inquiry |
| DFNB31-1509R | Recombinant Rat DFNB31 Protein, His (Fc)-Avi-tagged | +Inquiry |
| DFNB31-1851R | Recombinant Rat DFNB31 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DFNB31 Products
Required fields are marked with *
My Review for All DFNB31 Products
Required fields are marked with *
