Recombinant Human DFNB31 Protein, GST-tagged

Cat.No. : DFNB31-2561H
Product Overview : Human DFNB31 partial ORF ( NP_056219, 808 a.a. - 907 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene is thought to function in the organization and stabilization of sterocilia elongation and actin cystoskeletal assembly, based on studies of the related mouse gene. Mutations in this gene have been associated with autosomal recessive non-syndromic deafness and Usher Syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2016]
Molecular Mass : 36.74 kDa
AA Sequence : GLLEPTSTLVRVKKSAATLGIAIEGGANTRQPLPRIVTIQRGGSAHNCGQLKVGHVILEVNGLTLRGKEHREAARIIAEAFKTKDRDYIDFLVTEFNVML
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DFNB31 deafness, autosomal recessive 31 [ Homo sapiens ]
Official Symbol DFNB31
Synonyms DFNB31; deafness, autosomal recessive 31; whirlin; CIP98; USH2D; WHRN; CASK-interacting protein CIP98; autosomal recessive deafness type 31 protein; WI; RP11-9M16.1; KIAA1526; DKFZp434N014;
Gene ID 25861
mRNA Refseq NM_001083885
Protein Refseq NP_001077354
MIM 607928
UniProt ID Q9P202

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DFNB31 Products

Required fields are marked with *

My Review for All DFNB31 Products

Required fields are marked with *

0
cart-icon
0
compare icon