Recombinant Human DGAT1 Transmembrane protein, His&Myc-tagged
| Cat.No. : | DGAT1-2366H |
| Product Overview : | Recombinant Human DGAT1 protein(O75907)(240-488aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 240-488aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 37.1 kDa |
| AA Sequence : | TVSYPDNLTYRDLYYFLFAPTLCYELNFPRSPRIRKRFLLRRILEMLFFTQLQVGLIQQWMVPTIQNSMKPFKDMDYSRIIERLLKLAVPNHLIWLIFFYWLFHSCLNAVAELMQFGDREFYRDWWNSESVTYFWQNWNIPVHKWCIRHFYKPMLRRGSSKWMARTGVFLASAFFHEYLVSVPLRMFRLWAFTGMMAQIPLAWFVGRFFQGNYGNAAVWLSLIIGQPIAVLMYVHDYYVLNYEAPAAEA |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | DGAT1 diacylglycerol O-acyltransferase 1 [ Homo sapiens ] |
| Official Symbol | DGAT1 |
| Synonyms | DGAT1; diacylglycerol O-acyltransferase 1; diacylglycerol O acyltransferase homolog 1 (mouse); ARGP1; DGAT; ACAT related gene product 1; ACAT-related gene product 1; diglyceride acyltransferase; diacylglycerol O-acyltransferase homolog 1; acyl coenzyme A:cholesterol acyltransferase related gene 1; |
| Gene ID | 8694 |
| mRNA Refseq | NM_012079 |
| Protein Refseq | NP_036211 |
| MIM | 604900 |
| UniProt ID | O75907 |
| ◆ Cell & Tissue Lysates | ||
| DGAT1-480HKCL | Human DGAT1 Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DGAT1 Products
Required fields are marked with *
My Review for All DGAT1 Products
Required fields are marked with *
