Recombinant Human DGCR6 Protein, GST-tagged

Cat.No. : DGCR6-2565H
Product Overview : Human DGCR6 full-length ORF ( NP_005666.2, 1 a.a. - 220 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : DiGeorge syndrome, and more widely, the CATCH 22 syndrome, are associated with microdeletions in chromosomal region 22q11.2. The product of this gene shares homology with the Drosophila melanogaster gonadal protein, which participates in gonadal and germ cell development, and with the gamma-1 subunit of human laminin. This gene is a candidate for involvement in DiGeorge syndrome pathology and in schizophrenia. [provided by RefSeq, Nov 2008]
Molecular Mass : 51.4 kDa
AA Sequence : MERYAGALEEVADGARQQERHYQLLSALQSLVKELPSSFQQRLSYTTLSDLALALLDGTVFEIVQGLLEIQHLTEKSLYNQRLRLQNEHRVLRQALRQKHQEAQQACRPHNLPVLQAAQQRELEAVEHRIREEQRAMDQKIVLELDRKVADQQSTLEKAGVAGFYVTTNPQELMLQMNLLELIRKLQQRGCWAGKAALGLGGPWQLPAAQCDQKGSPVPP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DGCR6 DiGeorge syndrome critical region gene 6 [ Homo sapiens ]
Official Symbol DGCR6
Synonyms DGCR6; DiGeorge syndrome critical region gene 6; protein DGCR6; DiGeorge syndrome critical region protein 6;
Gene ID 8214
mRNA Refseq NM_005675
Protein Refseq NP_005666
MIM 601279
UniProt ID Q14129

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DGCR6 Products

Required fields are marked with *

My Review for All DGCR6 Products

Required fields are marked with *

0
cart-icon
0
compare icon