Recombinant Human DGKK Protein, GST-tagged
| Cat.No. : | DGKK-2576H |
| Product Overview : | Human DGKK partial ORF ( NP_001013764, 1171 a.a. - 1271 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene is an enzyme that phosphorylates diacylglycerol, converting it to phosphatidic acid. The encoded protein is a membrane protein and is inhibited by hydrogen peroxide. Variations in this gene have been associated with hypospadias. [provided by RefSeq, Mar 2011] |
| Molecular Mass : | 36.85 kDa |
| AA Sequence : | AEDETALQSALDAMNKEFKKLSEIDWMNPIFVPEEKSSDTDSRSLRLKIKFPKLGKKKVEEERKPKSGQSVQSFIGNLWHRRHREDEAEGDDPLTPSRSQL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DGKK diacylglycerol kinase, kappa [ Homo sapiens ] |
| Official Symbol | DGKK |
| Synonyms | DGKK; diacylglycerol kinase, kappa; diacylglycerol kinase kappa; DGK-kappa; DAG kinase kappa; diglyceride kinase kappa; 142 kDa diacylglycerol kinase; |
| Gene ID | 139189 |
| mRNA Refseq | NM_001013742 |
| Protein Refseq | NP_001013764 |
| MIM | 300837 |
| UniProt ID | Q5KSL6 |
| ◆ Recombinant Proteins | ||
| DGKK-18H | Recombinant Active Human DGKK Protein, His-tagged | +Inquiry |
| DGKK-4633H | Recombinant Human DGKK protein, His-tagged | +Inquiry |
| DGKK-2576H | Recombinant Human DGKK Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DGKK Products
Required fields are marked with *
My Review for All DGKK Products
Required fields are marked with *



