Recombinant Human DHDDS Protein (1-333 aa), GST-tagged
Cat.No. : | DHDDS-2138H |
Product Overview : | Recombinant Human DHDDS Protein (1-333 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-333 aa |
Description : | With DHDDS, forms the dehydrodolichyl diphosphate synthase (DDS) complex, an essential component of the dolichol monophosphate (Dol-P) biosynthetic machinery. Adds multiple copies of isopentenyl pyrophosphate (IPP) to farnesyl pyrophosphate (FPP) to produce dehydrodolichyl diphosphate (Dedol-PP), a precusrosor of dolichol which is utilized as a sugar carrier in protein glycosylation in the endoplasmic reticulum (ER). Regulates the glycosylation and stability of nascent NPC2, thereby promoting trafficking of LDL-derived cholesterol. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 65.7 kDa |
AA Sequence : | MSWIKEGELSLWERFCANIIKAGPMPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFKRSKSEVDGLMDLARQKFSRLMEEKEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQATKNYNKCFLNVCFAYTSRHEISNAVREMAWGVEQGLLDPSDISESLLDKCLYTNRSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQPVLWPEYTFWNLFEAILQFQMNHSVLQKARDMYAEERKRQQLERDQATVTEQLLREGLQASGDAQLRRTRLHKLSARREERVQGFLQALELKRADWLARLGTASA |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | DHDDS dehydrodolichyl diphosphate synthase [ Homo sapiens ] |
Official Symbol | DHDDS |
Synonyms | DHDDS; FLJ13102; HDS; dedol-PP synthase; CIT; CPT; RP59; |
Gene ID | 79947 |
mRNA Refseq | NM_001243564 |
Protein Refseq | NP_001230493 |
MIM | 608172 |
UniProt ID | Q86SQ9 |
◆ Recombinant Proteins | ||
DHDDS-2583H | Recombinant Human DHDDS Protein, GST-tagged | +Inquiry |
DHDDS-2524HF | Recombinant Full Length Human DHDDS Protein, GST-tagged | +Inquiry |
DHDDS-2138H | Recombinant Human DHDDS Protein (1-333 aa), GST-tagged | +Inquiry |
Dhdds-2543M | Recombinant Mouse Dhdds Protein, Myc/DDK-tagged | +Inquiry |
DHDDS-12399Z | Recombinant Zebrafish DHDDS | +Inquiry |
◆ Cell & Tissue Lysates | ||
DHDDS-6948HCL | Recombinant Human DHDDS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DHDDS Products
Required fields are marked with *
My Review for All DHDDS Products
Required fields are marked with *
0
Inquiry Basket