Recombinant Full Length Human DHDDS Protein, GST-tagged
Cat.No. : | DHDDS-2524HF |
Product Overview : | Human DHDDS full-length ORF ( AAH04117.1, 1 a.a. - 294 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 294 amino acids |
Description : | The protein encoded by this gene catalyzes cis-prenyl chain elongation to produce the polyprenyl backbone of dolichol, a glycosyl carrier lipid required for the biosynthesis of several classes of glycoproteins. Mutations in this gene are associated with retinitis pigmentosa type 59. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Aug 2011] |
Molecular Mass : | 60.7 kDa |
AA Sequence : | MSWIKEGELSLWERFCANIIKAGPMPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFKRSKSEVDGLMDLARQKFSRLMEEKCFLNVCFAYTSRHEISNAVREMAWGVEQGLLDPSDISESLLDKCLYTNRSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQPVLWPEYTFWNLFEAILQFQMNHSVLQKARDMYAEERKRQQLERDQATVTEQLLREGLQASGDAQLRRTRLHKLSARREERVQGFLQALELKRADWLARLGTASA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DHDDS dehydrodolichyl diphosphate synthase [ Homo sapiens ] |
Official Symbol | DHDDS |
Synonyms | DHDDS; dehydrodolichyl diphosphate synthase; DS; FLJ13102; HDS; dedol-PP synthase; cis-prenyl transferase; cis-isoprenyltransferase; CIT; CPT; RP59; |
Gene ID | 79947 |
mRNA Refseq | NM_001243564 |
Protein Refseq | NP_001230493 |
MIM | 608172 |
UniProt ID | Q86SQ9 |
◆ Recombinant Proteins | ||
Dhdds-2543M | Recombinant Mouse Dhdds Protein, Myc/DDK-tagged | +Inquiry |
DHDDS-2583H | Recombinant Human DHDDS Protein, GST-tagged | +Inquiry |
DHDDS-2524HF | Recombinant Full Length Human DHDDS Protein, GST-tagged | +Inquiry |
DHDDS-12399Z | Recombinant Zebrafish DHDDS | +Inquiry |
DHDDS-2138H | Recombinant Human DHDDS Protein (1-333 aa), GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DHDDS-6948HCL | Recombinant Human DHDDS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DHDDS Products
Required fields are marked with *
My Review for All DHDDS Products
Required fields are marked with *