Recombinant Full Length Human DHDDS Protein, GST-tagged

Cat.No. : DHDDS-2524HF
Product Overview : Human DHDDS full-length ORF ( AAH04117.1, 1 a.a. - 294 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 294 amino acids
Description : The protein encoded by this gene catalyzes cis-prenyl chain elongation to produce the polyprenyl backbone of dolichol, a glycosyl carrier lipid required for the biosynthesis of several classes of glycoproteins. Mutations in this gene are associated with retinitis pigmentosa type 59. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Aug 2011]
Molecular Mass : 60.7 kDa
AA Sequence : MSWIKEGELSLWERFCANIIKAGPMPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFKRSKSEVDGLMDLARQKFSRLMEEKCFLNVCFAYTSRHEISNAVREMAWGVEQGLLDPSDISESLLDKCLYTNRSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQPVLWPEYTFWNLFEAILQFQMNHSVLQKARDMYAEERKRQQLERDQATVTEQLLREGLQASGDAQLRRTRLHKLSARREERVQGFLQALELKRADWLARLGTASA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DHDDS dehydrodolichyl diphosphate synthase [ Homo sapiens ]
Official Symbol DHDDS
Synonyms DHDDS; dehydrodolichyl diphosphate synthase; DS; FLJ13102; HDS; dedol-PP synthase; cis-prenyl transferase; cis-isoprenyltransferase; CIT; CPT; RP59;
Gene ID 79947
mRNA Refseq NM_001243564
Protein Refseq NP_001230493
MIM 608172
UniProt ID Q86SQ9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DHDDS Products

Required fields are marked with *

My Review for All DHDDS Products

Required fields are marked with *

0
cart-icon