Recombinant Human DHFR2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | DHFR2-4353H |
Product Overview : | DHFRL1 MS Standard C13 and N15-labeled recombinant protein (NP_789785) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Key enzyme in folate metabolism. Contributes to the de novo mitochondrial thymidylate biosynthesis pathway. Required to prevent uracil accumulation in mtDNA. Binds its own mRNA and that of DHFR. |
Molecular Mass : | 21.6 kDa |
AA Sequence : | MFLLLNCIVAVSQNMGIGKNGDLPRPPLRNEFRYFQRMTTTSSVEGKQNLVIMGRKTWFSIPEKNRPLKDRINLVLSRELKEPPQGAHFLARSLDDALKLTERPELANKVDMIWIVGGSSVYKEAMNHLGHLKLFVTRIMQDFESDTFFSEIDLEKYKLLPEYPGVLSDVQEGKHIKYKFEVCEKDDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | DHFR2 dihydrofolate reductase 2 [ Homo sapiens (human) ] |
Official Symbol | DHFR2 |
Synonyms | DHFR2; dihydrofolate reductase 2; DHFRL1; DHFRP4; dihydrofolate reductase 2, mitochondrial; dihydrofolate reductase like 1; dihydrofolate reductase pseudogene 4; dihydrofolate reductase, mitochondrial; dihydrofolate reductase-like protein 1; EC 1.5.1.3 |
Gene ID | 200895 |
mRNA Refseq | NM_176815 |
Protein Refseq | NP_789785 |
MIM | 616588 |
UniProt ID | Q86XF0 |
◆ Recombinant Proteins | ||
DHFR2-4353H | Recombinant Human DHFR2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DHFR2-756H | Recombinant Human DHFR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
DHFR2-966HFL | Recombinant Full Length Human DHFR2 Protein, C-Flag-tagged | +Inquiry |
DHFR2-2530HF | Recombinant Full Length Human DHFR2 Protein, GST-tagged | +Inquiry |
DHFR2-2588H | Recombinant Human DHFR2 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DHFR2 Products
Required fields are marked with *
My Review for All DHFR2 Products
Required fields are marked with *