Recombinant Human DHFR2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : DHFR2-4353H
Product Overview : DHFRL1 MS Standard C13 and N15-labeled recombinant protein (NP_789785) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Key enzyme in folate metabolism. Contributes to the de novo mitochondrial thymidylate biosynthesis pathway. Required to prevent uracil accumulation in mtDNA. Binds its own mRNA and that of DHFR.
Molecular Mass : 21.6 kDa
AA Sequence : MFLLLNCIVAVSQNMGIGKNGDLPRPPLRNEFRYFQRMTTTSSVEGKQNLVIMGRKTWFSIPEKNRPLKDRINLVLSRELKEPPQGAHFLARSLDDALKLTERPELANKVDMIWIVGGSSVYKEAMNHLGHLKLFVTRIMQDFESDTFFSEIDLEKYKLLPEYPGVLSDVQEGKHIKYKFEVCEKDDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name DHFR2 dihydrofolate reductase 2 [ Homo sapiens (human) ]
Official Symbol DHFR2
Synonyms DHFR2; dihydrofolate reductase 2; DHFRL1; DHFRP4; dihydrofolate reductase 2, mitochondrial; dihydrofolate reductase like 1; dihydrofolate reductase pseudogene 4; dihydrofolate reductase, mitochondrial; dihydrofolate reductase-like protein 1; EC 1.5.1.3
Gene ID 200895
mRNA Refseq NM_176815
Protein Refseq NP_789785
MIM 616588
UniProt ID Q86XF0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DHFR2 Products

Required fields are marked with *

My Review for All DHFR2 Products

Required fields are marked with *

0
cart-icon