Recombinant Human DHFR2 Protein, GST-tagged
Cat.No. : | DHFR2-2588H |
Product Overview : | Human DHFRL1 full-length ORF ( NP_789785.1, 1 a.a. - 187 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | DHFR2 (Dihydrofolate Reductase 2) is a Protein Coding gene. Among its related pathways are One carbon pool by folate and Metabolism of water-soluble vitamins and cofactors. An important paralog of this gene is DHFR. |
Molecular Mass : | 48 kDa |
AA Sequence : | MFLLLNCIVAVSQNMGIGKNGDLPRPPLRNEFRYFQRMTTTSSVEGKQNLVIMGRKTWFSIPEKNRPLKDRINLVLSRELKEPPQGAHFLARSLDDALKLTERPELANKVDMIWIVGGSSVYKEAMNHLGHLKLFVTRIMQDFESDTFFSEIDLEKYKLLPEYPGVLSDVQEGKHIKYKFEVCEKDD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DHFR2 dihydrofolate reductase 2 [ Homo sapiens (human) ] |
Official Symbol | DHFR2 |
Synonyms | DHFR2; dihydrofolate reductase 2; DHFRL1; dihydrofolate reductase-like 1; DHFRP4, dihydrofolate reductase pseudogene 4; dihydrofolate reductase, mitochondrial; FLJ16119; dihydrofolate reductase pseudogene 4; dihydrofolate reductase-like protein 1; DHFRP4; |
Gene ID | 200895 |
mRNA Refseq | NM_001195643 |
Protein Refseq | NP_001182572 |
MIM | 616588 |
UniProt ID | Q86XF0 |
◆ Recombinant Proteins | ||
DHFR2-4353H | Recombinant Human DHFR2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DHFR2-756H | Recombinant Human DHFR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
DHFR2-2530HF | Recombinant Full Length Human DHFR2 Protein, GST-tagged | +Inquiry |
DHFR2-2588H | Recombinant Human DHFR2 Protein, GST-tagged | +Inquiry |
DHFR2-966HFL | Recombinant Full Length Human DHFR2 Protein, C-Flag-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DHFR2 Products
Required fields are marked with *
My Review for All DHFR2 Products
Required fields are marked with *