Recombinant Human DHFR2 Protein, GST-tagged

Cat.No. : DHFR2-2588H
Product Overview : Human DHFRL1 full-length ORF ( NP_789785.1, 1 a.a. - 187 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : DHFR2 (Dihydrofolate Reductase 2) is a Protein Coding gene. Among its related pathways are One carbon pool by folate and Metabolism of water-soluble vitamins and cofactors. An important paralog of this gene is DHFR.
Molecular Mass : 48 kDa
AA Sequence : MFLLLNCIVAVSQNMGIGKNGDLPRPPLRNEFRYFQRMTTTSSVEGKQNLVIMGRKTWFSIPEKNRPLKDRINLVLSRELKEPPQGAHFLARSLDDALKLTERPELANKVDMIWIVGGSSVYKEAMNHLGHLKLFVTRIMQDFESDTFFSEIDLEKYKLLPEYPGVLSDVQEGKHIKYKFEVCEKDD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DHFR2 dihydrofolate reductase 2 [ Homo sapiens (human) ]
Official Symbol DHFR2
Synonyms DHFR2; dihydrofolate reductase 2; DHFRL1; dihydrofolate reductase-like 1; DHFRP4, dihydrofolate reductase pseudogene 4; dihydrofolate reductase, mitochondrial; FLJ16119; dihydrofolate reductase pseudogene 4; dihydrofolate reductase-like protein 1; DHFRP4;
Gene ID 200895
mRNA Refseq NM_001195643
Protein Refseq NP_001182572
MIM 616588
UniProt ID Q86XF0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DHFR2 Products

Required fields are marked with *

My Review for All DHFR2 Products

Required fields are marked with *

0
cart-icon