Recombinant Full Length Human DHFR2 Protein, GST-tagged

• Cat.No.: DHFR2-2530HF
• Product Overview: Human DHFRL1 full-length ORF ( NP_789785.1, 1 a.a. - 187 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 187 amino acids
• Description: DHFR2 (Dihydrofolate Reductase 2) is a Protein Coding gene. Among its related pathways are One carbon pool by folate and Metabolism of water-soluble vitamins and cofactors. An important paralog of this gene is DHFR.
• Molecular Mass: 48 kDa
• AA Sequence: MFLLLNCIVAVSQNMGIGKNGDLPRPPLRNEFRYFQRMTTTSSVEGKQNLVIMGRKTWFSIPEKNRPLKDRINLVLSRELKEPPQGAHFLARSLDDALKLTERPELANKVDMIWIVGGSSVYKEAMNHLGHLKLFVTRIMQDFESDTFFSEIDLEKYKLLPEYPGVLSDVQEGKHIKYKFEVCEKDD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DHFR2 dihydrofolate reductase 2 [ Homo sapiens (human) ]
• Official Symbol: DHFR2
• Synonyms: DHFR2; dihydrofolate reductase 2; DHFRL1; dihydrofolate reductase-like 1; DHFRP4, dihydrofolate reductase pseudogene 4; dihydrofolate reductase, mitochondrial; FLJ16119; dihydrofolate reductase pseudogene 4; dihydrofolate reductase-like protein 1; DHFRP4
• Gene ID: 200895
• mRNA Refseq: NM_001195643
• Protein Refseq: NP_001182572
• MIM: 616588
• UniProt ID: Q86XF0