Recombinant Full Length Human DHFR2 Protein, C-Flag-tagged

• Cat.No.: DHFR2-966HFL
• Product Overview: Recombinant Full Length Human DHFR2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: Enables dihydrofolate reductase activity and mRNA binding activity. Involved in tetrahydrofolate metabolic process and thymidine biosynthetic process. Located in mitochondrial inner membrane and mitochondrial matrix.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 21.4 kDa
• AA Sequence: MFLLLNCIVAVSQNMGIGKNGDLPRPPLRNEFRYFQRMTTTSSVEGKQNLVIMGRKTWFSIPEKNRPLKD RINLVLSRELKEPPQGAHFLARSLDDALKLTERPELANKVDMIWIVGGSSVYKEAMNHLGHLKLFVTRIM
  QDFESDTFFSEIDLEKYKLLPEYPGVLSDVQEGKHIKYKFEVCEKDDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Druggable Genome
• Full Length: Full L.

Gene Information

• Gene Name: DHFR2 dihydrofolate reductase 2 [ Homo sapiens (human) ]
• Official Symbol: DHFR2
• Synonyms: DHFRL1; DHFRP4
• Gene ID: 200895
• mRNA Refseq: NM_176815.5
• Protein Refseq: NP_789785.1
• MIM: 616588
• UniProt ID: Q86XF0