Recombinant Human DHRS13 Protein, GST-tagged
Cat.No. : | DHRS13-2595H |
Product Overview : | Human DHRS13 full-length ORF ( NP_653284.1, 1 a.a. - 327 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | DHRS13 (Dehydrogenase/Reductase 13) is a Protein Coding gene. GO annotations related to this gene include oxidoreductase activity and coenzyme binding. An important paralog of this gene is RDH12. |
Molecular Mass : | 62.2 kDa |
AA Sequence : | MTALELARRGARVVLACRSQERGEAAAFDLRQESGNNEVIFMALDLASLASVRAFATAFLSSEPRLDILIHNAGISSCGRTREAFNLLLRVNHIGPFLLTHLLLPCLKACAPSRVVVVASAAHCRGRLDFKRLDRPVVGWRQELRAYADTKLANVLFARELANQLEATGVTCYAAHPGPVNSELFLRHVPGWLRPLLRPLAWLVLRAPRGGAQTPLYCALQEGIEPLSGRYFANCHVEEVPPAARDDRAAHRLWEASKRLAGLGPGEDAEPDEDPQSEDSEAPSSLSTPHPEEPTVSQPYPSPQSSPDLSKMTHRIQAKVEPEIQLS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DHRS13 dehydrogenase/reductase (SDR family) member 13 [ Homo sapiens ] |
Official Symbol | DHRS13 |
Synonyms | DHRS13; dehydrogenase/reductase (SDR family) member 13; dehydrogenase/reductase SDR family member 13; MGC23280; SDR7C5; short chain dehydrogenase/reductase family 7C; member 5; short chain dehydrogenase/reductase family 7C, member 5; |
Gene ID | 147015 |
mRNA Refseq | NM_144683 |
Protein Refseq | NP_653284 |
MIM | 616157 |
UniProt ID | Q6UX07 |
◆ Recombinant Proteins | ||
DHRS13-2358M | Recombinant Mouse DHRS13 Protein, His (Fc)-Avi-tagged | +Inquiry |
DHRS13-351H | Recombinant Human DHRS13 Protein, His-tagged | +Inquiry |
DHRS13-2595H | Recombinant Human DHRS13 Protein, GST-tagged | +Inquiry |
DHRS13-4562M | Recombinant Mouse DHRS13 Protein | +Inquiry |
DHRS13-1256R | Recombinant Rhesus monkey DHRS13 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DHRS13-6938HCL | Recombinant Human DHRS13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DHRS13 Products
Required fields are marked with *
My Review for All DHRS13 Products
Required fields are marked with *
0
Inquiry Basket