Recombinant Human DHRS7 protein, His-tagged
Cat.No. : | DHRS7-11977H |
Product Overview : | Recombinant Human DHRS7 protein(27-183 aa), fused with N-terminal His tag, was expressed in E.coli. |
Availability | July 22, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 27-183 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | RADGDLTLLWAEWQGRRPEWELTDMVVWVTGASSGIGEELAYQLSKLGVSLVLSARRVHELERVKRRCLENGNLKEKDILVLPLDLTDTGSHEAATKAVLQEFGRIDILVNNGGMSQRSLCMDTSLDVYRKLIELNYLGTVSLTKCVLPHMIERKQG |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | DHRS7 dehydrogenase/reductase (SDR family) member 7 [ Homo sapiens ] |
Official Symbol | DHRS7 |
Synonyms | DHRS7; dehydrogenase/reductase (SDR family) member 7; dehydrogenase/reductase SDR family member 7; retDSR4; retinal short chain dehydrogenase/reductase 4; SDR34C1; short chain dehydrogenase/reductase family 34C; member 1; retinal short-chain dehydrogenase/reductase 4; short chain dehydrogenase/reductase family 34C, member 1; CGI-86; retSDR4; |
Gene ID | 51635 |
mRNA Refseq | NM_016029 |
Protein Refseq | NP_057113 |
MIM | 612833 |
UniProt ID | Q9Y394 |
◆ Recombinant Proteins | ||
DHRS7-2541HF | Recombinant Full Length Human DHRS7 Protein, GST-tagged | +Inquiry |
DHRS7-1259R | Recombinant Rhesus monkey DHRS7 Protein, His-tagged | +Inquiry |
DHRS7-1172H | Recombinant Human DHRS7 Protein (29-339 aa), His-SUMO-tagged | +Inquiry |
DHRS7-4566M | Recombinant Mouse DHRS7 Protein | +Inquiry |
DHRS7-1084R | Recombinant Rhesus Macaque DHRS7 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DHRS7-472HCL | Recombinant Human DHRS7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DHRS7 Products
Required fields are marked with *
My Review for All DHRS7 Products
Required fields are marked with *