Recombinant Human DHX38 Protein, GST-tagged

Cat.No. : DHX38-2612H
Product Overview : Human DHX38 partial ORF ( NP_054722.2, 342 a.a. - 450 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The protein encoded by this gene is a member of the DEAD/H box family of splicing factors. This protein resembles yeast Prp16 more closely than other DEAD/H family members. It is an ATPase and essential for the catalytic step II in pre-mRNA splicing process. [provided by RefSeq, Jul 2008]
Molecular Mass : 37.73 kDa
AA Sequence : YSSEDYVRRREQHLHKQKQKRISAQRRQINEDNERWETNRMLTSGVVHRLEVDEDFEEDNAAKVHLMVHNLVPPFLDGRIVFTKQPEPVIPVKDATSDLAIIARKGSQT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DHX38 DEAH (Asp-Glu-Ala-His) box polypeptide 38 [ Homo sapiens ]
Official Symbol DHX38
Synonyms DHX38; DEAH (Asp-Glu-Ala-His) box polypeptide 38; DDX38, DEAD/H (Asp Glu Ala Asp/His) box polypeptide 38; pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16; hPrp16; KIAA0224; PRP16; PRPF16; DEAH box protein 38; PRP16 homolog of S.cerevisiae; ATP-dependent RNA helicase DHX38; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 38; pre-mRNA splicing factor ATP-dependent RNA helicase PRP16; DDX38;
Gene ID 9785
mRNA Refseq NM_014003
Protein Refseq NP_054722
MIM 605584
UniProt ID Q92620

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DHX38 Products

Required fields are marked with *

My Review for All DHX38 Products

Required fields are marked with *

0
cart-icon