Recombinant Human DHX8 Protein, GST-tagged

Cat.No. : DHX8-2615H
Product Overview : Human DHX8 partial ORF ( NP_004932, 301 a.a. - 400 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene is a member of the DEAH box polypeptide family. The encoded protein contains the DEAH (Asp-Glu-Ala-His) motif which is characteristic of all DEAH box proteins, and is thought to function as an ATP-dependent RNA helicase that regulates the release of spliced mRNAs from spliceosomes prior to their export from the nucleus. This protein may be required for the replication of human immunodeficiency virus type 1 (HIV-1). Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2014]
Molecular Mass : 36.74 kDa
AA Sequence : RREGRVANVADVVSKGQRVKVKVLSFTGTKTSLSMKDVDQETGEDLNPNRRRNLVGETNEETSMRNPDRPTHLSLVSAPEVEDDSLERKRLTRISDPEKW
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DHX8 DEAH (Asp-Glu-Ala-His) box polypeptide 8 [ Homo sapiens ]
Official Symbol DHX8
Synonyms DHX8; DEAH (Asp-Glu-Ala-His) box polypeptide 8; DDX8, DEAD/H (Asp Glu Ala Asp/His) box polypeptide 8 (RNA helicase); ATP-dependent RNA helicase DHX8; HRH1; PRP22; PRPF22; RNA helicase HRH1; DEAH box protein 8; DEAH-box protein 8; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 8 (RNA helicase); DDX8;
Gene ID 1659
mRNA Refseq NM_004941
Protein Refseq NP_004932
MIM 600396
UniProt ID Q14562

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DHX8 Products

Required fields are marked with *

My Review for All DHX8 Products

Required fields are marked with *

0
cart-icon
0
compare icon