Recombinant Human DHX9 protein, GST-tagged

Cat.No. : DHX9-631H
Product Overview : Recombinant Human DHX9(1 a.a. - 90 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1 a.a. - 90 a.a.
Description : This gene encodes a member of the DEAH-containing family of RNA helicases. The encoded protein is an enzyme that catalyzes the ATP-dependent unwinding of double-stranded RNA and DNA-RNA complexes. This protein localizes to both the nucleus and the cytoplasm and functions as a transcriptional regulator. This protein may also be involved in the expression and nuclear export of retroviral RNAs. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 11 and 13.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 35.64 kDa
AA Sequence : MGDVKNFLYAWCGKRKMTPSYEIRAVGNKNRQKFMCEVQVEGYNYTGMGNSTNKKDAQSNAARDFVNYLVRINEIKSEEVPAFGVASPPP
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name DHX9 DEAH (Asp-Glu-Ala-His) box polypeptide 9 [ Homo sapiens ]
Official Symbol DHX9
Synonyms DHX9; DEAH (Asp-Glu-Ala-His) box polypeptide 9; DDX9, DEAD/H (Asp Glu Ala Asp/His) box polypeptide 9 (RNA helicase A, nuclear DNA helicase II; leukophysin) , LKP; ATP-dependent RNA helicase A; NDH II; RHA; leukophysin; DEAH box protein 9; nuclear DNA helicase II; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 9; LKP; DDX9; NDH2; NDHII; FLJ17406;
Gene ID 1660
mRNA Refseq NM_001357
Protein Refseq NP_001348
MIM 603115
UniProt ID Q08211
Chromosome Location 1q25
Pathway Gene expression, organism-specific biosystem; Processing of Capped Intron-Containing Pre-mRNA, organism-specific biosystem; mRNA Splicing, organism-specific biosystem; mRNA Splicing - Major Pathway, organism-specific biosystem; mRNA processing, organism-specific biosystem;
Function ATP binding; ATP-dependent DNA helicase activity; ATP-dependent RNA helicase activity; DNA binding; RNA helicase activity; RNA polymerase II transcription factor binding; double-stranded RNA binding; hydrolase activity; nucleotide binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DHX9 Products

Required fields are marked with *

My Review for All DHX9 Products

Required fields are marked with *

0
cart-icon