Recombinant Human DIABLO Protein, GST-tagged
Cat.No. : | DIABLO-2619H |
Product Overview : | Human DIABLO full-length ORF (BAG50903.1, 1 a.a. - 186 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes an inhibitor of apoptosis protein (IAP)-binding protein. The encoded mitochondrial protein enters the cytosol when cells undergo apoptosis, and allows activation of caspases by binding to inhibitor of apoptosis proteins. Overexpression of the encoded protein sensitizes tumor cells to apoptosis. A mutation in this gene is associated with young-adult onset of nonsyndromic deafness-64. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, May 2013] |
Molecular Mass : | 47.6 kDa |
AA Sequence : | MKSDFYFQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DIABLO diablo, IAP-binding mitochondrial protein [ Homo sapiens ] |
Official Symbol | DIABLO |
Synonyms | DIABLO; diablo, IAP-binding mitochondrial protein; diablo homolog, mitochondrial; DFNA64; DIABLO S; FLJ10537; FLJ25049; second mitochondria derived activator of caspase; SMAC; 0610041G12Rik; mitochondrial Smac protein; direct IAP-binding protein with low pI; second mitochondria-derived activator of caspase; SMAC3; DIABLO-S; |
Gene ID | 56616 |
mRNA Refseq | NM_019887 |
Protein Refseq | NP_063940 |
MIM | 605219 |
UniProt ID | Q9NR28 |
◆ Recombinant Proteins | ||
DIABLO-4587M | Recombinant Mouse DIABLO Protein | +Inquiry |
DIABLO-4238H | Recombinant Human DIABLO Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DIABLO-2619H | Recombinant Human DIABLO Protein, GST-tagged | +Inquiry |
DIABLO-3897H | Recombinant Human DIABLO Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DIABLO-0877H | Recombinant Human DIABLO Protein (A56-D239), Tag Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
DIABLO-6927HCL | Recombinant Human DIABLO 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DIABLO Products
Required fields are marked with *
My Review for All DIABLO Products
Required fields are marked with *