Recombinant Human DIDO1 Protein, GST-tagged

Cat.No. : DIDO1-2351H
Product Overview : Human DATF1 partial ORF ( AAH14489, 321 a.a. - 420 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Apoptosis, a major form of cell death, is an efficient mechanism for eliminating unwanted cells and is of central importance for development and homeostasis in metazoan animals. In mice, the death inducer-obliterator-1 gene is upregulated by apoptotic signals and encodes a cytoplasmic protein that translocates to the nucleus upon apoptotic signal activation. When overexpressed, the mouse protein induced apoptosis in cell lines growing in vitro. This gene is similar to the mouse gene and therefore is thought to be involved in apoptosis. Alternatively spliced transcripts have been found for this gene, encoding multiple isoforms. [provided by RefSeq, Jul 2008]
Molecular Mass : 36.41 kDa
AA Sequence : ILQVQDETHSETADQQEAKWRPGDADGTDCTSIGTIEQKSSEDQGIKGRIEKAANPSGKKKLKIFQPVIEAPGASKCIGPGCCHVAQPDSVYCSNDCILK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DIDO1 death inducer-obliterator 1 [ Homo sapiens ]
Official Symbol DIDO1
Synonyms DIDO1; death inducer-obliterator 1; C20orf158, chromosome 20 open reading frame 158 , DATF1, death associated transcription factor 1; death-inducer obliterator 1; BYE1; DIO 1; DIO1; dJ885L7.8; FLJ11265; KIAA0333; death-associated transcription factor 1; DATF1; DIDO2; DIDO3; DIO-1; DATF-1; C20orf158; MGC16140; DKFZp434P1115;
Gene ID 11083
mRNA Refseq NM_001193369
Protein Refseq NP_001180298
MIM 604140
UniProt ID Q9BTC0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DIDO1 Products

Required fields are marked with *

My Review for All DIDO1 Products

Required fields are marked with *

0
cart-icon
0
compare icon