Recombinant Human DIDO1 Protein, GST-tagged
| Cat.No. : | DIDO1-2351H |
| Product Overview : | Human DATF1 partial ORF ( AAH14489, 321 a.a. - 420 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Apoptosis, a major form of cell death, is an efficient mechanism for eliminating unwanted cells and is of central importance for development and homeostasis in metazoan animals. In mice, the death inducer-obliterator-1 gene is upregulated by apoptotic signals and encodes a cytoplasmic protein that translocates to the nucleus upon apoptotic signal activation. When overexpressed, the mouse protein induced apoptosis in cell lines growing in vitro. This gene is similar to the mouse gene and therefore is thought to be involved in apoptosis. Alternatively spliced transcripts have been found for this gene, encoding multiple isoforms. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 36.41 kDa |
| AA Sequence : | ILQVQDETHSETADQQEAKWRPGDADGTDCTSIGTIEQKSSEDQGIKGRIEKAANPSGKKKLKIFQPVIEAPGASKCIGPGCCHVAQPDSVYCSNDCILK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DIDO1 death inducer-obliterator 1 [ Homo sapiens ] |
| Official Symbol | DIDO1 |
| Synonyms | DIDO1; death inducer-obliterator 1; C20orf158, chromosome 20 open reading frame 158 , DATF1, death associated transcription factor 1; death-inducer obliterator 1; BYE1; DIO 1; DIO1; dJ885L7.8; FLJ11265; KIAA0333; death-associated transcription factor 1; DATF1; DIDO2; DIDO3; DIO-1; DATF-1; C20orf158; MGC16140; DKFZp434P1115; |
| Gene ID | 11083 |
| mRNA Refseq | NM_001193369 |
| Protein Refseq | NP_001180298 |
| MIM | 604140 |
| UniProt ID | Q9BTC0 |
| ◆ Recombinant Proteins | ||
| DIDO1-01H | Recombinant Human DIDO1, His-tagged | +Inquiry |
| DIDO1-4915Z | Recombinant Zebrafish DIDO1 | +Inquiry |
| DIDO1-2351H | Recombinant Human DIDO1 Protein, GST-tagged | +Inquiry |
| DIDO1-1710H | Recombinant Human DIDO1 Protein (Lys258-Cys455), N-His tagged | +Inquiry |
| DIDO1-4592M | Recombinant Mouse DIDO1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DIDO1-478HCL | Recombinant Human DIDO1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DIDO1 Products
Required fields are marked with *
My Review for All DIDO1 Products
Required fields are marked with *
