Recombinant Human DIO2 Protein, GST-tagged
Cat.No. : | DIO2-2628H |
Product Overview : | Human DIO2 partial ORF ( NP_054644, 166 a.a. - 265 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene belongs to the iodothyronine deiodinase family. It catalyzes the conversion of prohormone thyroxine (3,5,3',5'-tetraiodothyronine, T4) to the bioactive thyroid hormone (3,5,3'-triiodothyronine, T3) by outer ring 5'-deiodination. This gene is widely expressed, including in thyroid, placenta, pituitary and brain. It is thought to be responsible for the 'local' production of T3, and thus important in influencing thyroid hormone action in these tissues. It has also been reported to be highly expressed in thyroids of patients with Graves disease, and in follicular adenomas. The intrathyroidal T4 to T3 conversion by this enzyme may contribute significantly to the relative increase in thyroidal T3 production in these patients. This protein is a selenoprotein containing the rare selenocysteine (Sec) amino acid at its active site, and may contain additional Sec residues. Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. Alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, May 2016] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | PSDGWAIPGDSSLSFEVKKHQNQEDRCAAAQQLLERFSLPPQCRVVADRMDNNANIAYGVAFERVCIVQRQKIAYLGGKGPFSYNLQEVRHWLEKNFSKR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DIO2 deiodinase, iodothyronine, type II [ Homo sapiens ] |
Official Symbol | DIO2 |
Synonyms | DIO2; deiodinase, iodothyronine, type II; type II iodothyronine deiodinase; SelY; thyroxine deiodinase; type II; TXDI2; type 2 DI; type-II 5deiodinase; type-II 5-deiodinase; thyroxine deiodinase, type II; type 2 iodothyronine deiodinase; D2; 5DII; DIOII; |
Gene ID | 1734 |
mRNA Refseq | NM_000793 |
Protein Refseq | NP_000784 |
MIM | 601413 |
UniProt ID | Q92813 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DIO2 Products
Required fields are marked with *
My Review for All DIO2 Products
Required fields are marked with *
0
Inquiry Basket