Recombinant Human DIO2 Protein, GST-tagged

Cat.No. : DIO2-2628H
Product Overview : Human DIO2 partial ORF ( NP_054644, 166 a.a. - 265 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene belongs to the iodothyronine deiodinase family. It catalyzes the conversion of prohormone thyroxine (3,5,3',5'-tetraiodothyronine, T4) to the bioactive thyroid hormone (3,5,3'-triiodothyronine, T3) by outer ring 5'-deiodination. This gene is widely expressed, including in thyroid, placenta, pituitary and brain. It is thought to be responsible for the 'local' production of T3, and thus important in influencing thyroid hormone action in these tissues. It has also been reported to be highly expressed in thyroids of patients with Graves disease, and in follicular adenomas. The intrathyroidal T4 to T3 conversion by this enzyme may contribute significantly to the relative increase in thyroidal T3 production in these patients. This protein is a selenoprotein containing the rare selenocysteine (Sec) amino acid at its active site, and may contain additional Sec residues. Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. Alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, May 2016]
Molecular Mass : 36.74 kDa
AA Sequence : PSDGWAIPGDSSLSFEVKKHQNQEDRCAAAQQLLERFSLPPQCRVVADRMDNNANIAYGVAFERVCIVQRQKIAYLGGKGPFSYNLQEVRHWLEKNFSKR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DIO2 deiodinase, iodothyronine, type II [ Homo sapiens ]
Official Symbol DIO2
Synonyms DIO2; deiodinase, iodothyronine, type II; type II iodothyronine deiodinase; SelY; thyroxine deiodinase; type II; TXDI2; type 2 DI; type-II 5deiodinase; type-II 5-deiodinase; thyroxine deiodinase, type II; type 2 iodothyronine deiodinase; D2; 5DII; DIOII;
Gene ID 1734
mRNA Refseq NM_000793
Protein Refseq NP_000784
MIM 601413
UniProt ID Q92813

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DIO2 Products

Required fields are marked with *

My Review for All DIO2 Products

Required fields are marked with *

0
cart-icon