Recombinant Full Length Human Type Ii Iodothyronine Deiodinase(Dio2) Protein, His-Tagged
Cat.No. : | RFL30280HF |
Product Overview : | Recombinant Full Length Human Type II iodothyronine deiodinase(DIO2) Protein (Q92813) (1-273aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-273) |
Form : | Lyophilized powder |
AA Sequence : | MGILSVDLLITLQILPVFFSNCLFLALYDSVILLKHVVLLLSRSKSTRGEWRRMLTSEGL RCVWKSFLLDAYKQVKLGEDAPNSSVVHVSSTEGGDNSGNGTQEKIAEGATCHLLDFASP ERPLVVNFGSATUPPFTSQLPAFRKLVEEFSSVADFLLVYIDEAHPSDGWAIPGDSSLSF EVKKHQNQEDRCAAAQQLLERFSLPPQCRVVADRMDNNANIAYGVAFERVCIVQRQKIAY LGGKGPFSYNLQEVRHWLEKNFSKRUKKTRLAG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | DIO2 |
Synonyms | DIO2; ITDI2; TXDI2; Type II iodothyronine deiodinase; 5DII; DIOII; Type 2 DI; Type-II 5'-deiodinase |
UniProt ID | Q92813 |
◆ Recombinant Proteins | ||
Dio2-1340M | Recombinant Mouse Dio2 Protein, His-tagged | +Inquiry |
DIO2-1869R | Recombinant Rat DIO2 Protein | +Inquiry |
DIO2-532H | Recombinant Human DIO2 | +Inquiry |
DIO2-2798H | Recombinant Human DIO2 Protein, His (Fc)-Avi-tagged | +Inquiry |
DIO2-5690C | Recombinant Chicken DIO2 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DIO2 Products
Required fields are marked with *
My Review for All DIO2 Products
Required fields are marked with *
0
Inquiry Basket