Recombinant Human DIP2A Protein, GST-tagged

• Cat.No.: DIP2A-2631H
• Product Overview: Human DIP2A partial ORF ( NP_055966, 1 a.a. - 99 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene may be involved in axon patterning in the central nervous system. This gene is not highly expressed. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2009]
• Molecular Mass: 36.63 kDa
• AA Sequence: MADRGCPLEAAPLPAEVRESLAELELELSEGDITQKGYEKKRAKLLARYIPLIQGIDPSLQAENRIPGPSQTTAAAPKQQKSRPTASRDERFRSDVHTE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DIP2A DIP2 disco-interacting protein 2 homolog A (Drosophila) [ Homo sapiens ]
• Official Symbol: DIP2A
• Synonyms: DIP2A; DIP2 disco-interacting protein 2 homolog A (Drosophila); C21orf106, chromosome 21 open reading frame 106; disco-interacting protein 2 homolog A; Dip2; KIAA0184; DIP2 homolog A; disco-interacting protein 2A; DIP2; C21orf106
• Gene ID: 23181
• mRNA Refseq: NM_001146114
• Protein Refseq: NP_001139586
• MIM: 607711
• UniProt ID: Q14689