Recombinant Human DIP2A Protein, GST-tagged
| Cat.No. : | DIP2A-2631H | 
| Product Overview : | Human DIP2A partial ORF ( NP_055966, 1 a.a. - 99 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | GST | 
| Description : | The protein encoded by this gene may be involved in axon patterning in the central nervous system. This gene is not highly expressed. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2009] | 
| Molecular Mass : | 36.63 kDa | 
| AA Sequence : | MADRGCPLEAAPLPAEVRESLAELELELSEGDITQKGYEKKRAKLLARYIPLIQGIDPSLQAENRIPGPSQTTAAAPKQQKSRPTASRDERFRSDVHTE | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | DIP2A DIP2 disco-interacting protein 2 homolog A (Drosophila) [ Homo sapiens ] | 
| Official Symbol | DIP2A | 
| Synonyms | DIP2A; DIP2 disco-interacting protein 2 homolog A (Drosophila); C21orf106, chromosome 21 open reading frame 106; disco-interacting protein 2 homolog A; Dip2; KIAA0184; DIP2 homolog A; disco-interacting protein 2A; DIP2; C21orf106; | 
| Gene ID | 23181 | 
| mRNA Refseq | NM_001146114 | 
| Protein Refseq | NP_001139586 | 
| MIM | 607711 | 
| UniProt ID | Q14689 | 
| ◆ Recombinant Proteins | ||
| DIP2A-11998H | Recombinant Human DIP2A, GST-tagged | +Inquiry | 
| DIP2A-2631H | Recombinant Human DIP2A Protein, GST-tagged | +Inquiry | 
| DIP2A-1467H | Recombinant Human DIP2A protein, hFc-tagged | +Inquiry | 
| DIP2A-1454H | Recombinant Human DIP2A protein, His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| DIP2A-479HCL | Recombinant Human DIP2A cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DIP2A Products
Required fields are marked with *
My Review for All DIP2A Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            