Recombinant Human DIP2A Protein, GST-tagged

Cat.No. : DIP2A-2631H
Product Overview : Human DIP2A partial ORF ( NP_055966, 1 a.a. - 99 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene may be involved in axon patterning in the central nervous system. This gene is not highly expressed. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2009]
Molecular Mass : 36.63 kDa
AA Sequence : MADRGCPLEAAPLPAEVRESLAELELELSEGDITQKGYEKKRAKLLARYIPLIQGIDPSLQAENRIPGPSQTTAAAPKQQKSRPTASRDERFRSDVHTE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DIP2A DIP2 disco-interacting protein 2 homolog A (Drosophila) [ Homo sapiens ]
Official Symbol DIP2A
Synonyms DIP2A; DIP2 disco-interacting protein 2 homolog A (Drosophila); C21orf106, chromosome 21 open reading frame 106; disco-interacting protein 2 homolog A; Dip2; KIAA0184; DIP2 homolog A; disco-interacting protein 2A; DIP2; C21orf106;
Gene ID 23181
mRNA Refseq NM_001146114
Protein Refseq NP_001139586
MIM 607711
UniProt ID Q14689

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DIP2A Products

Required fields are marked with *

My Review for All DIP2A Products

Required fields are marked with *

0
cart-icon
0
compare icon