Recombinant Human DIRAS1 protein, GST-tagged
Cat.No. : | DIRAS1-11999H |
Product Overview : | Recombinant Human DIRAS1 protein(1-198 aa), fused with N-terminal GST tag, was expressed in E.coli. |
Availability | September 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-198 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | MPEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCDKSVCTLQITDTTGSHQFPAMQRLSISKGHAFILVFSVTSKQSLEELGPIYKLIVQIKGSVEDIPVMLVGNKCDETQREVDTREAQAVAQEWKCAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGKRSGKQKRTDRVKGKCTLM |
Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | DIRAS1 DIRAS family, GTP-binding RAS-like 1 [ Homo sapiens ] |
Official Symbol | DIRAS1 |
Synonyms | DIRAS1; DIRAS family, GTP-binding RAS-like 1; GTP-binding protein Di-Ras1; Di Ras1; GBTS1; RIG; ras-related inhibitor of cell growth; small GTP-binding tumor suppressor 1; distinct subgroup of the Ras family member 1; Di-Ras1; FLJ42681; |
Gene ID | 148252 |
mRNA Refseq | NM_145173 |
Protein Refseq | NP_660156 |
MIM | 607862 |
UniProt ID | O95057 |
◆ Recombinant Proteins | ||
DIRAS1-2817H | Recombinant Human DIRAS1, His-tagged | +Inquiry |
DIRAS1-28349TH | Recombinant Human DIRAS1, His-tagged | +Inquiry |
DIRAS1-4599M | Recombinant Mouse DIRAS1 Protein | +Inquiry |
DIRAS1-3539H | Recombinant Human DIRAS1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Diras1-2566M | Recombinant Mouse Diras1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DIRAS1-6922HCL | Recombinant Human DIRAS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DIRAS1 Products
Required fields are marked with *
My Review for All DIRAS1 Products
Required fields are marked with *