Recombinant Human DIRAS1 protein, GST-tagged
| Cat.No. : | DIRAS1-11999H |
| Product Overview : | Recombinant Human DIRAS1 protein(1-198 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | June 18, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-198 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
| AASequence : | MPEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCDKSVCTLQITDTTGSHQFPAMQRLSISKGHAFILVFSVTSKQSLEELGPIYKLIVQIKGSVEDIPVMLVGNKCDETQREVDTREAQAVAQEWKCAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGKRSGKQKRTDRVKGKCTLM |
| Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | DIRAS1 DIRAS family, GTP-binding RAS-like 1 [ Homo sapiens ] |
| Official Symbol | DIRAS1 |
| Synonyms | DIRAS1; DIRAS family, GTP-binding RAS-like 1; GTP-binding protein Di-Ras1; Di Ras1; GBTS1; RIG; ras-related inhibitor of cell growth; small GTP-binding tumor suppressor 1; distinct subgroup of the Ras family member 1; Di-Ras1; FLJ42681; |
| Gene ID | 148252 |
| mRNA Refseq | NM_145173 |
| Protein Refseq | NP_660156 |
| MIM | 607862 |
| UniProt ID | O95057 |
| ◆ Recombinant Proteins | ||
| DIRAS1-2817H | Recombinant Human DIRAS1, His-tagged | +Inquiry |
| DIRAS1-28349TH | Recombinant Human DIRAS1, His-tagged | +Inquiry |
| DIRAS1-2381M | Recombinant Mouse DIRAS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| DIRAS1-1267R | Recombinant Rhesus monkey DIRAS1 Protein, His-tagged | +Inquiry |
| DIRAS1-2570HF | Recombinant Full Length Human DIRAS1 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DIRAS1-6922HCL | Recombinant Human DIRAS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DIRAS1 Products
Required fields are marked with *
My Review for All DIRAS1 Products
Required fields are marked with *
