Recombinant Human DIRAS1 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | DIRAS1-3539H |
| Product Overview : | DIRAS1 MS Standard C13 and N15-labeled recombinant protein (NP_660156) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | DIRAS1 belongs to a distinct branch of the functionally diverse Ras (see HRAS) superfamily of monomeric GTPases. |
| Molecular Mass : | 22.3 kDa |
| AA Sequence : | MPEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCDKSVCTLQITDTTGSHQFPAMQRLSISKGHAFILVFSVTSKQSLEELGPIYKLIVQIKGSVEDIPVMLVGNKCDETQREVDTREAQAVAQEWKCAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGKRSGKQKRTDRVKGKCTLMTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | DIRAS1 DIRAS family GTPase 1 [ Homo sapiens (human) ] |
| Official Symbol | DIRAS1 |
| Synonyms | DIRAS1; DIRAS family, GTP-binding RAS-like 1; GTP-binding protein Di-Ras1; Di Ras1; GBTS1; RIG; ras-related inhibitor of cell growth; small GTP-binding tumor suppressor 1; distinct subgroup of the Ras family member 1; Di-Ras1; FLJ42681; |
| Gene ID | 148252 |
| mRNA Refseq | NM_145173 |
| Protein Refseq | NP_660156 |
| MIM | 607862 |
| UniProt ID | O95057 |
| ◆ Recombinant Proteins | ||
| DIRAS1-11999H | Recombinant Human DIRAS1 protein, GST-tagged | +Inquiry |
| Diras1-2566M | Recombinant Mouse Diras1 Protein, Myc/DDK-tagged | +Inquiry |
| DIRAS1-2381M | Recombinant Mouse DIRAS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| DIRAS1-2570HF | Recombinant Full Length Human DIRAS1 Protein, GST-tagged | +Inquiry |
| DIRAS1-2817H | Recombinant Human DIRAS1, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DIRAS1-6922HCL | Recombinant Human DIRAS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DIRAS1 Products
Required fields are marked with *
My Review for All DIRAS1 Products
Required fields are marked with *



