Recombinant Human DIRAS1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | DIRAS1-3539H |
Product Overview : | DIRAS1 MS Standard C13 and N15-labeled recombinant protein (NP_660156) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | DIRAS1 belongs to a distinct branch of the functionally diverse Ras (see HRAS) superfamily of monomeric GTPases. |
Molecular Mass : | 22.3 kDa |
AA Sequence : | MPEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCDKSVCTLQITDTTGSHQFPAMQRLSISKGHAFILVFSVTSKQSLEELGPIYKLIVQIKGSVEDIPVMLVGNKCDETQREVDTREAQAVAQEWKCAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGKRSGKQKRTDRVKGKCTLMTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | DIRAS1 DIRAS family GTPase 1 [ Homo sapiens (human) ] |
Official Symbol | DIRAS1 |
Synonyms | DIRAS1; DIRAS family, GTP-binding RAS-like 1; GTP-binding protein Di-Ras1; Di Ras1; GBTS1; RIG; ras-related inhibitor of cell growth; small GTP-binding tumor suppressor 1; distinct subgroup of the Ras family member 1; Di-Ras1; FLJ42681; |
Gene ID | 148252 |
mRNA Refseq | NM_145173 |
Protein Refseq | NP_660156 |
MIM | 607862 |
UniProt ID | O95057 |
◆ Recombinant Proteins | ||
DIRAS1-28349TH | Recombinant Human DIRAS1, His-tagged | +Inquiry |
DIRAS1-2634H | Recombinant Human DIRAS1 Protein, GST-tagged | +Inquiry |
DIRAS1-2817H | Recombinant Human DIRAS1, His-tagged | +Inquiry |
DIRAS1-11999H | Recombinant Human DIRAS1 protein, GST-tagged | +Inquiry |
DIRAS1-2570HF | Recombinant Full Length Human DIRAS1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DIRAS1-6922HCL | Recombinant Human DIRAS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DIRAS1 Products
Required fields are marked with *
My Review for All DIRAS1 Products
Required fields are marked with *
0
Inquiry Basket