Recombinant Human DIRAS2 Protein, GST-tagged
| Cat.No. : | DIRAS2-2636H |
| Product Overview : | Human DIRAS2 full-length ORF ( NP_060064.2, 1 a.a. - 199 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | DIRAS2 belongs to a distinct branch of the functionally diverse Ras (see HRAS; MIM 190020) superfamily of monomeric GTPases.[supplied by OMIM, Apr 2004] |
| Molecular Mass : | 48.9 kDa |
| AA Sequence : | MPEQSNDYRVAVFGAGGVGKSSLVLRFVKGTFRESYIPTVEDTYRQVISCDKSICTLQITDTTGSHQFPAMQRLSISKGHAFILVYSITSRQSLEELKPIYEQICEIKGDVESIPIMLVGNKCDESPSREVQSSEAEALARTWKCAFMETSAKLNHNVKELFQELLNLEKRRTVSLQIDGKKSKQQKRKEKLKGKCVIM |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DIRAS2 DIRAS family, GTP-binding RAS-like 2 [ Homo sapiens ] |
| Official Symbol | DIRAS2 |
| Synonyms | DIRAS2; DIRAS family, GTP-binding RAS-like 2; GTP-binding protein Di-Ras2; Di Ras2; DKFZp761C07121; distinct subgroup of the Ras family member 2; Di-Ras2; |
| Gene ID | 54769 |
| mRNA Refseq | NM_017594 |
| Protein Refseq | NP_060064 |
| MIM | 607863 |
| UniProt ID | Q96HU8 |
| ◆ Recombinant Proteins | ||
| DIRAS2-1093R | Recombinant Rhesus Macaque DIRAS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| DIRAS2-763H | Recombinant Human DIRAS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| DIRAS2-116H | Recombinant Human DIRAS2 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
| DIRAS2-2000HFL | Recombinant Full Length Human DIRAS2 Protein, C-Flag-tagged | +Inquiry |
| DIRAS2-12000H | Recombinant Human DIRAS2 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DIRAS2-6921HCL | Recombinant Human DIRAS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DIRAS2 Products
Required fields are marked with *
My Review for All DIRAS2 Products
Required fields are marked with *
