Recombinant Human DLEU1 Protein, GST-tagged
| Cat.No. : | DLEU1-2672H |
| Product Overview : | Human DLEU1 full-length ORF ( AAH20692, 1 a.a. - 78 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | DLEU1 (Deleted In Lymphocytic Leukemia 1 (Non-Protein Coding)) is an RNA Gene, and is affiliated with the non-coding RNA class. |
| Molecular Mass : | 34.32 kDa |
| AA Sequence : | MRPCIWIHVHLKPPCRLVELLPFSSALQGLSHLSLGTTLPVILPERNEEQNLQELSHNADKYQMGDCCKEEIDDSIFY |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DLEU1 deleted in lymphocytic leukemia 1 (non-protein coding) [Homo sapiens] |
| Official Symbol | DLEU1 |
| Synonyms | deleted in lymphocytic leukemia 1 (non-protein coding); DLEU2; LEU1; LEU2; XTP6; MGC22430; NCRNA00021; Deleted in lymphocytic leukemia 1; deleted in lymphocytic leukemia, 1; HBV X-transactivated gene 6 protein; BCMS; HBV XAg-transactivated protein 6; DLB1; B-cell neoplasia-associated gene with multiple splicing; leukemia-associated protein 2; long intergenic non-protein coding RNA 21; FLJ92453; MGC22430 |
| Gene ID | 10301 |
| MIM | 605765 |
| UniProt ID | O43261 |
| ◆ Recombinant Proteins | ||
| DLEU1-12018H | Recombinant Human DLEU1, GST-tagged | +Inquiry |
| DLEU1-3976HF | Recombinant Full Length Human DLEU1 Protein, GST-tagged | +Inquiry |
| DLEU1-2672H | Recombinant Human DLEU1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DLEU1 Products
Required fields are marked with *
My Review for All DLEU1 Products
Required fields are marked with *
