Recombinant Human DLEU2 Protein, GST-tagged

• Cat.No.: DLEU2-2673H
• Product Overview: Human DLEU2 full-length ORF ( O43262, 1 a.a. - 84 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: DLEU2 (Deleted In Lymphocytic Leukemia 2 (Non-Protein Coding)) is an RNA Gene, and is affiliated with the non-coding RNA class.
• Molecular Mass: 36.6 kDa
• AA Sequence: MRLRFNNDRMKTTIKETTILSSAILTFLTYLMKMSFERCTARNKMFVNSPFYPRVDNYCTSSWKKFYLKCYFSLNTIKKEKKMT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DLEU2 deleted in lymphocytic leukemia 2 (non-protein coding) [ Homo sapiens (human) ]
• Official Symbol: DLEU2
• Synonyms: DLEU2; deleted in lymphocytic leukemia 2 (non-protein coding); Deleted In Lymphocytic Leukemia 2 (Non-Protein Coding); Mir-15a-16-1 Cluster Host Gene (Non-Protein Coding); Long Intergenic Non-Protein Coding RNA 22; Ret Finger Protein 2 Opposite Strand; Deleted In Lymphocytic Leukemia, 2; Leukemia Associated Gene; Non-Protein Coding RNA 22; NCRNA00022; LINC00022; MIR15AHG; TRIM13OS; BCMSUN; RFP2OS; Leu2; DLB2; 1B4; deleted in lymphocytic leukemia, 2; leukemia associated gene 2; long intergenic non-protein coding RNA 22; mir-15a-16-1 cluster host gene (non-protein coding); ret finger protein 2 opposite strand
• Gene ID: 8847
• MIM: 605766