Recombinant Human DLEU2 Protein, GST-tagged
Cat.No. : | DLEU2-2673H |
Product Overview : | Human DLEU2 full-length ORF ( O43262, 1 a.a. - 84 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | DLEU2 (Deleted In Lymphocytic Leukemia 2 (Non-Protein Coding)) is an RNA Gene, and is affiliated with the non-coding RNA class. |
Molecular Mass : | 36.6 kDa |
AA Sequence : | MRLRFNNDRMKTTIKETTILSSAILTFLTYLMKMSFERCTARNKMFVNSPFYPRVDNYCTSSWKKFYLKCYFSLNTIKKEKKMT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DLEU2 deleted in lymphocytic leukemia 2 (non-protein coding) [ Homo sapiens (human) ] |
Official Symbol | DLEU2 |
Synonyms | DLEU2; deleted in lymphocytic leukemia 2 (non-protein coding); Deleted In Lymphocytic Leukemia 2 (Non-Protein Coding); Mir-15a-16-1 Cluster Host Gene (Non-Protein Coding); Long Intergenic Non-Protein Coding RNA 22; Ret Finger Protein 2 Opposite Strand; Deleted In Lymphocytic Leukemia, 2; Leukemia Associated Gene; Non-Protein Coding RNA 22; NCRNA00022; LINC00022; MIR15AHG; TRIM13OS; BCMSUN; RFP2OS; Leu2; DLB2; 1B4; deleted in lymphocytic leukemia, 2; leukemia associated gene 2; long intergenic non-protein coding RNA 22; mir-15a-16-1 cluster host gene (non-protein coding); ret finger protein 2 opposite strand |
Gene ID | 8847 |
MIM | 605766 |
◆ Recombinant Proteins | ||
DLEU2-2673H | Recombinant Human DLEU2 Protein, GST-tagged | +Inquiry |
DLEU2-3978HF | Recombinant Full Length Human DLEU2 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DLEU2 Products
Required fields are marked with *
My Review for All DLEU2 Products
Required fields are marked with *