Recombinant Human DLEU2 Protein, GST-tagged

Cat.No. : DLEU2-2673H
Product Overview : Human DLEU2 full-length ORF ( O43262, 1 a.a. - 84 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : DLEU2 (Deleted In Lymphocytic Leukemia 2 (Non-Protein Coding)) is an RNA Gene, and is affiliated with the non-coding RNA class.
Molecular Mass : 36.6 kDa
AA Sequence : MRLRFNNDRMKTTIKETTILSSAILTFLTYLMKMSFERCTARNKMFVNSPFYPRVDNYCTSSWKKFYLKCYFSLNTIKKEKKMT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DLEU2 deleted in lymphocytic leukemia 2 (non-protein coding) [ Homo sapiens (human) ]
Official Symbol DLEU2
Synonyms DLEU2; deleted in lymphocytic leukemia 2 (non-protein coding); Deleted In Lymphocytic Leukemia 2 (Non-Protein Coding); Mir-15a-16-1 Cluster Host Gene (Non-Protein Coding); Long Intergenic Non-Protein Coding RNA 22; Ret Finger Protein 2 Opposite Strand; Deleted In Lymphocytic Leukemia, 2; Leukemia Associated Gene; Non-Protein Coding RNA 22; NCRNA00022; LINC00022; MIR15AHG; TRIM13OS; BCMSUN; RFP2OS; Leu2; DLB2; 1B4; deleted in lymphocytic leukemia, 2; leukemia associated gene 2; long intergenic non-protein coding RNA 22; mir-15a-16-1 cluster host gene (non-protein coding); ret finger protein 2 opposite strand
Gene ID 8847
MIM 605766

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DLEU2 Products

Required fields are marked with *

My Review for All DLEU2 Products

Required fields are marked with *

0
cart-icon
0
compare icon