Recombinant Human DLG2 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | DLG2-1342H |
| Product Overview : | DLG2 MS Standard C13 and N15-labeled recombinant protein (NP_001136174) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes a member of the membrane-associated guanylate kinase (MAGUK) family. The encoded protein forms a heterodimer with a related family member that may interact at postsynaptic sites to form a multimeric scaffold for the clustering of receptors, ion channels, and associated signaling proteins. Multiple transcript variants encoding different isoforms have been found for this gene. Additional transcript variants have been described, but their full-length nature is not known. |
| Molecular Mass : | 38.2 kDa |
| AA Sequence : | MMNHSMSSGSGSLRTNQKRSLYVRAMFDYDKSKDSGLPSQGLSFKYGDILHVINASDDEWWQARRVMLEGDSEEMGVIPSKRRVERKERARLKTVKFNAKPGVIDSKGDIPGLGDDGYGTKTLRGQEDLILSYEPVTRQEINYTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVISREQMEKDIQEHKFIEAGQYNDNLYGTSVQSVRFVAERGKHCILDVSGNAIKRLQVAQLYPIAIFIKPRSLEPLMEMNKRLTEEQAKKTYDRAIKLEQEFGEYFTAIVQGDTLEDIYNQCKLVIEEQSGPFIWIPSKEKLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | DLG2 discs large MAGUK scaffold protein 2 [ Homo sapiens (human) ] |
| Official Symbol | DLG2 |
| Synonyms | DLG2; discs, large homolog 2 (Drosophila); discs, large homolog 2, chapsyn 110 (Drosophila); disks large homolog 2; chapsyn 110; PPP1R58; protein phosphatase 1; regulatory subunit 58; PSD 93; PSD93; discs, large homolog 2, chapsyn-110; postsynaptic density protein PSD-93; channel-associated protein of synapse-110; protein phosphatase 1, regulatory subunit 58; channel-associated protein of synapses, 110kDa; PSD-93; chapsyn-110; FLJ37266; MGC131811; DKFZp781D1854; DKFZp781E0954; |
| Gene ID | 1740 |
| mRNA Refseq | NM_001142702 |
| Protein Refseq | NP_001136174 |
| MIM | 603583 |
| UniProt ID | Q15700 |
| ◆ Recombinant Proteins | ||
| DLG2-2033Z | Recombinant Zebrafish DLG2 | +Inquiry |
| DLG2-1538R | Recombinant Rat DLG2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| DLG2-773H | Recombinant Human DLG2 Protein, His-tagged | +Inquiry |
| DLG2-2218H | Recombinant Human DLG2 Protein, MYC/DDK-tagged | +Inquiry |
| Dlg2-2575M | Recombinant Mouse Dlg2 Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DLG2 Products
Required fields are marked with *
My Review for All DLG2 Products
Required fields are marked with *
