Recombinant Human DLG4 protein, His-tagged

• Cat.No.: DLG4-18H
• Product Overview: Recombinant Human Disks large homolog 4/DLG4/PSD95 is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Leu724) of Human DLG4 fused with a polyhistidine tag at the N-terminus.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-724 a.a.
• Form: Lyophilized from a 0.2 μm filtered solution of PBS,pH 7.4
• AA Sequence: MNHKVHHHHHHMDCLCIVTTKKYRYQDEDTPPLEHSPAHLPNQANSPPVIVNTDTLEAPGYELQV NGTEGEMEYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILF VNEVDVREVTHSAAVEALKEAGSIVRLYVMRRKPPAEKVMEIKLIKGPKGLGFSIAGGVGNQHIP GDNSIYVTKIIEGGAAHKDGRLQIGDKILAVNSVGLEDVMHEDAVAALKNTYDVVYLKVAKPSNA YLSDSYAPPDITTSYSQHLDNEISHSSYLGTDYPTAMTPTSPRRYSPVAKDLLGEEDIPREPRRI VIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIAL KNAGQTVTIIAQYKPEEYSRFEAKIHDLREQLMNSSLGSGTASLRSNPKRGFYIRALFDYDKTKD CGFLSQALSFRFGDVLHVIDAGDEEWWQARRVHSDSETDDIGFIPSKRRVERREWSRLKAKDWGS SSGSQGREDSVLSYETVTQMEVHYARPIIILGPTKDRANDDLLSEFPDKFGSCVPHTTRPKREYE IDGRDYHFVSSREKMEKDIQAHKFIEAGQYNSHLYGTSVQSVREVAEQGKHCILDVSANAVRRLQ AAHLHPIAIFIRPRSLENVLEINKRITEEQARKAFDRATKLEQEFTECFSAIVEGDSFEEIYHKV KRVIEDLSGPYIWVPARERL
• Endotoxin: Less than 0.1 ng/µg (1 IEU/µg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
• Storage: Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
• Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: DLG4 discs, large homolog 4 (Drosophila) [ Homo sapiens ]
• Official Symbol: DLG4
• Synonyms: DLG4; discs, large homolog 4 (Drosophila); disks large homolog 4; PSD 95; PSD95; SAP 90; SAP90; discs large homolog 4; Tax interaction protein 15; synapse-associated protein 90; postsynaptic density protein 95; post-synaptic density protein 95; SAP-90; FLJ97752; FLJ98574
• Gene ID: 1742
• mRNA Refseq: NM_001365
• Protein Refseq: NP_001356
• MIM: 602887
• UniProt ID: P78352
• Chromosome Location: 17p13.1
• Pathway: Activation of Ca-permeable Kainate Receptor, organism-specific biosystem; Activation of Kainate Receptors upon glutamate binding, organism-specific biosystem; Activation of NMDA receptor upon glutamate binding and postsynaptic events, organism-specific biosystem; Axon guidance, organism-specific biosystem; CREB phosphorylation through the activation of CaMKII, organism-specific biosystem; CREB phosphorylation through the activation of Ras, organism-specific biosystem; Cocaine addiction, organism-specific biosystem
• Function: protein C-terminus binding; protein binding; scaffold protein binding