Recombinant Human DLG4 protein, His-tagged
| Cat.No. : | DLG4-18H |
| Product Overview : | Recombinant Human Disks large homolog 4/DLG4/PSD95 is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Leu724) of Human DLG4 fused with a polyhistidine tag at the N-terminus. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-724 a.a. |
| Form : | Lyophilized from a 0.2 μm filtered solution of PBS,pH 7.4 |
| AA Sequence : | MNHKVHHHHHHMDCLCIVTTKKYRYQDEDTPPLEHSPAHLPNQANSPPVIVNTDTLEAPGYELQV NGTEGEMEYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILF VNEVDVREVTHSAAVEALKEAGSIVRLYVMRRKPPAEKVMEIKLIKGPKGLGFSIAGGVGNQHIP GDNSIYVTKIIEGGAAHKDGRLQIGDKILAVNSVGLEDVMHEDAVAALKNTYDVVYLKVAKPSNA YLSDSYAPPDITTSYSQHLDNEISHSSYLGTDYPTAMTPTSPRRYSPVAKDLLGEEDIPREPRRI VIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIAL KNAGQTVTIIAQYKPEEYSRFEAKIHDLREQLMNSSLGSGTASLRSNPKRGFYIRALFDYDKTKD CGFLSQALSFRFGDVLHVIDAGDEEWWQARRVHSDSETDDIGFIPSKRRVERREWSRLKAKDWGS SSGSQGREDSVLSYETVTQMEVHYARPIIILGPTKDRANDDLLSEFPDKFGSCVPHTTRPKREYE IDGRDYHFVSSREKMEKDIQAHKFIEAGQYNSHLYGTSVQSVREVAEQGKHCILDVSANAVRRLQ AAHLHPIAIFIRPRSLENVLEINKRITEEQARKAFDRATKLEQEFTECFSAIVEGDSFEEIYHKV KRVIEDLSGPYIWVPARERL |
| Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg). |
| Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Storage : | Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months. |
| Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Gene Name | DLG4 discs, large homolog 4 (Drosophila) [ Homo sapiens ] |
| Official Symbol | DLG4 |
| Synonyms | DLG4; discs, large homolog 4 (Drosophila); disks large homolog 4; PSD 95; PSD95; SAP 90; SAP90; discs large homolog 4; Tax interaction protein 15; synapse-associated protein 90; postsynaptic density protein 95; post-synaptic density protein 95; SAP-90; FLJ97752; FLJ98574; |
| Gene ID | 1742 |
| mRNA Refseq | NM_001365 |
| Protein Refseq | NP_001356 |
| MIM | 602887 |
| UniProt ID | P78352 |
| Chromosome Location | 17p13.1 |
| Pathway | Activation of Ca-permeable Kainate Receptor, organism-specific biosystem; Activation of Kainate Receptors upon glutamate binding, organism-specific biosystem; Activation of NMDA receptor upon glutamate binding and postsynaptic events, organism-specific biosystem; Axon guidance, organism-specific biosystem; CREB phosphorylation through the activation of CaMKII, organism-specific biosystem; CREB phosphorylation through the activation of Ras, organism-specific biosystem; Cocaine addiction, organism-specific biosystem; |
| Function | protein C-terminus binding; protein binding; scaffold protein binding; |
| ◆ Recombinant Proteins | ||
| DLG4-727HF | Recombinant Full Length Human DLG4 Protein, GST-tagged | +Inquiry |
| DLG4-31002TH | Recombinant Human DLG4 | +Inquiry |
| DLG4-33H | Recombinant Human DLG4 Protein (WT), N-6×His tagged | +Inquiry |
| DLG4-2397M | Recombinant Mouse DLG4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| DLG4-902H | Recombinant Human DLG4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DLG4-6910HCL | Recombinant Human DLG4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DLG4 Products
Required fields are marked with *
My Review for All DLG4 Products
Required fields are marked with *
