Recombinant Human DLG4 Protein (Mut), N-6×His tagged

Cat.No. : DLG4-32H
Product Overview : Recombinant Human PDZ2 (Mut) Protein with N-6×His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : This gene encodes a member of the membrane-associated guanylate kinase (MAGUK) family. It heteromultimerizes with another MAGUK protein, DLG2, and is recruited into NMDA receptor and potassium channel clusters. These two MAGUK proteins may interact at postsynaptic sites to form a multimeric scaffold for the clustering of receptors, ion channels, and associated signaling proteins. Multiple transcript variants encoding different isoforms have been found for this gene.
Molecular Mass : ~25 kDa as estimated in SDS-PAGE under reducing conditions.
AA Sequence : MGGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSKLGYGRKKRRQRRRGGSTMSGYPYDVPDYAGSMAGTGLDKEAGSIVRLYVMRRKPPAEKVMEIKLITGPKGRGFSIAGGVGNQLIPGDNSIYVTKIIEGGAAHKDGRLQIGDKILAVNSVGLEDVMHEDAVAALKNTYDVVYLKVAKPSNAYLSDSYAPPDITTSYSQHLDNEISHSSYLGTDYPTAMTPTSPRRY
Endotoxin : < 0.1 EU/μg
Purity : > 95 % as determined by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade upon receiving. Recommend to aliquot the protein into smaller quantities for optimal storage. Avoid freeze/thaw cycles.
Storage Buffer : 50mMTris-HCl, pH8.0, 200mMNaCl, 20 % glycerol.
Gene Name DLG4 discs large MAGUK scaffold protein 4 [ Homo sapiens (human) ]
Official Symbol DLG4
Synonyms DLG4; discs large MAGUK scaffold protein 4; MRD62; PSD95; SAP90; SAP-90; disks large homolog 4; Tax interaction protein 15; discs large homolog 4; post-synaptic density protein 95; synapse-associated protein 90
Gene ID 1742
mRNA Refseq NM_001365
Protein Refseq NP_001356
MIM 602887
UniProt ID B9EGL1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DLG4 Products

Required fields are marked with *

My Review for All DLG4 Products

Required fields are marked with *

0
cart-icon