Recombinant Human DLG4 Protein (Mut), N-6×His tagged
Cat.No. : | DLG4-32H |
Product Overview : | Recombinant Human PDZ2 (Mut) Protein with N-6×His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | This gene encodes a member of the membrane-associated guanylate kinase (MAGUK) family. It heteromultimerizes with another MAGUK protein, DLG2, and is recruited into NMDA receptor and potassium channel clusters. These two MAGUK proteins may interact at postsynaptic sites to form a multimeric scaffold for the clustering of receptors, ion channels, and associated signaling proteins. Multiple transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | ~25 kDa as estimated in SDS-PAGE under reducing conditions. |
AA Sequence : | MGGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSKLGYGRKKRRQRRRGGSTMSGYPYDVPDYAGSMAGTGLDKEAGSIVRLYVMRRKPPAEKVMEIKLITGPKGRGFSIAGGVGNQLIPGDNSIYVTKIIEGGAAHKDGRLQIGDKILAVNSVGLEDVMHEDAVAALKNTYDVVYLKVAKPSNAYLSDSYAPPDITTSYSQHLDNEISHSSYLGTDYPTAMTPTSPRRY |
Endotoxin : | < 0.1 EU/μg |
Purity : | > 95 % as determined by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade upon receiving. Recommend to aliquot the protein into smaller quantities for optimal storage. Avoid freeze/thaw cycles. |
Storage Buffer : | 50mMTris-HCl, pH8.0, 200mMNaCl, 20 % glycerol. |
Gene Name | DLG4 discs large MAGUK scaffold protein 4 [ Homo sapiens (human) ] |
Official Symbol | DLG4 |
Synonyms | DLG4; discs large MAGUK scaffold protein 4; MRD62; PSD95; SAP90; SAP-90; disks large homolog 4; Tax interaction protein 15; discs large homolog 4; post-synaptic density protein 95; synapse-associated protein 90 |
Gene ID | 1742 |
mRNA Refseq | NM_001365 |
Protein Refseq | NP_001356 |
MIM | 602887 |
UniProt ID | B9EGL1 |
◆ Recombinant Proteins | ||
DLG4-2397M | Recombinant Mouse DLG4 Protein, His (Fc)-Avi-tagged | +Inquiry |
DLG4-1970H | Recombinant Human DLG4 Protein (Ile6-Ala249), N-His tagged | +Inquiry |
DLG4-4905HFL | Recombinant Full Length Human DLG4 protein, Flag-tagged | +Inquiry |
DLG4-33H | Recombinant Human DLG4 Protein (WT), N-6×His tagged | +Inquiry |
DLG4-727HF | Recombinant Full Length Human DLG4 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DLG4-6910HCL | Recombinant Human DLG4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DLG4 Products
Required fields are marked with *
My Review for All DLG4 Products
Required fields are marked with *
0
Inquiry Basket