Recombinant Human DLG5 Protein, GST-tagged

Cat.No. : DLG5-2679H
Product Overview : Human DLG5 partial ORF ( NP_004738, 1708 a.a. - 1809 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the family of discs large (DLG) homologs, a subset of the membrane-associated guanylate kinase (MAGUK) superfamily. The MAGUK proteins are composed of a catalytically inactive guanylate kinase domain, in addition to PDZ and SH3 domains, and are thought to function as scaffolding molecules at sites of cell-cell contact. The protein encoded by this gene localizes to the plasma membrane and cytoplasm, and interacts with components of adherens junctions and the cytoskeleton. It is proposed to function in the transmission of extracellular signals to the cytoskeleton and in the maintenance of epithelial cell structure. Alternative splice variants have been described but their biological nature has not been determined. [provided by RefSeq, Jul 2008]
Molecular Mass : 36.96 kDa
AA Sequence : LDIAPHAIERLHHMHIYPIVIFIHYKSAKHIKEQRDPIYLRDKVTQRHSKEQFEAAQKLEQEYSRYFTGVIQGGALSSICTQILAMVNQEQNKVLWIPACPL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DLG5 discs, large homolog 5 (Drosophila) [ Homo sapiens ]
Official Symbol DLG5
Synonyms DLG5; discs, large homolog 5 (Drosophila); discs, large (Drosophila) homolog 5; disks large homolog 5; KIAA0583; P dlg; large type of P-DLG; discs large protein P-dlg; placenta and prostate DLG; discs large protein LP-DLG; PDLG; LP-DLG; P-DLG5;
Gene ID 9231
mRNA Refseq NM_004747
Protein Refseq NP_004738
MIM 604090
UniProt ID Q8TDM6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DLG5 Products

Required fields are marked with *

My Review for All DLG5 Products

Required fields are marked with *

0
cart-icon