Recombinant Human DLG5 Protein, GST-tagged
| Cat.No. : | DLG5-2679H |
| Product Overview : | Human DLG5 partial ORF ( NP_004738, 1708 a.a. - 1809 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the family of discs large (DLG) homologs, a subset of the membrane-associated guanylate kinase (MAGUK) superfamily. The MAGUK proteins are composed of a catalytically inactive guanylate kinase domain, in addition to PDZ and SH3 domains, and are thought to function as scaffolding molecules at sites of cell-cell contact. The protein encoded by this gene localizes to the plasma membrane and cytoplasm, and interacts with components of adherens junctions and the cytoskeleton. It is proposed to function in the transmission of extracellular signals to the cytoskeleton and in the maintenance of epithelial cell structure. Alternative splice variants have been described but their biological nature has not been determined. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 36.96 kDa |
| AA Sequence : | LDIAPHAIERLHHMHIYPIVIFIHYKSAKHIKEQRDPIYLRDKVTQRHSKEQFEAAQKLEQEYSRYFTGVIQGGALSSICTQILAMVNQEQNKVLWIPACPL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DLG5 discs, large homolog 5 (Drosophila) [ Homo sapiens ] |
| Official Symbol | DLG5 |
| Synonyms | DLG5; discs, large homolog 5 (Drosophila); discs, large (Drosophila) homolog 5; disks large homolog 5; KIAA0583; P dlg; large type of P-DLG; discs large protein P-dlg; placenta and prostate DLG; discs large protein LP-DLG; PDLG; LP-DLG; P-DLG5; |
| Gene ID | 9231 |
| mRNA Refseq | NM_004747 |
| Protein Refseq | NP_004738 |
| MIM | 604090 |
| UniProt ID | Q8TDM6 |
| ◆ Recombinant Proteins | ||
| DLG5-2679H | Recombinant Human DLG5 Protein, GST-tagged | +Inquiry |
| DLG5-2267H | Recombinant Human DLG5 Protein (Asp1722-Asn1905), N-His tagged | +Inquiry |
| Dlg5-7833M | Recombinant Mouse Dlg5 protein, His & T7-tagged | +Inquiry |
| DLG5-7832H | Recombinant Human DLG5 protein, His & T7-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DLG5 Products
Required fields are marked with *
My Review for All DLG5 Products
Required fields are marked with *
