Recombinant Human DLK1 protein, His-tagged
| Cat.No. : | DLK1-2820H |
| Product Overview : | Recombinant Human DLK1 protein(P80370)(24-303aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 24-303aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 33.8 kDa |
| AA Sequence : | AECFPACNPQNGFCEDDNVCRCQPGWQGPLCDQCVTSPGCLHGLCGEPGQCICTDGWDGELCDRDVRACSSAPCANNRTCVSLDDGLYECSCAPGYSGKDCQKKDGPCVINGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANSCTPNPCENDGVCTDIGGDFRCRCPAGFIDKTCSRPVTNCASSPCQNGGTCLQHTQVSYECLCKPEFTGLTCVKKRALSPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLTEGQ |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | DLK1 delta-like 1 homolog (Drosophila) [ Homo sapiens ] |
| Official Symbol | DLK1 |
| Synonyms | DLK1; delta-like 1 homolog (Drosophila); delta like homolog (Drosophila); protein delta homolog 1; Delta1; FA1; pG2; Pref 1; ZOG; DLK-1; secredeltin; fetal antigen 1; preadipocyte factor 1; DLK; PREF1; Pref-1; |
| Gene ID | 8788 |
| mRNA Refseq | NM_003836 |
| Protein Refseq | NP_003827 |
| MIM | 176290 |
| UniProt ID | P80370 |
| ◆ Recombinant Proteins | ||
| DLK1-2262H | Recombinant Human DLK1 Protein (Ala24-Pro297), C-His tagged | +Inquiry |
| Dlk1-216M | Active Recombinant Mouse Dlk1 protein, His-tagged | +Inquiry |
| DLK1-2683H | Recombinant Human DLK1 Protein, GST-tagged | +Inquiry |
| Dlk1-1841R | Recombinant Rat Dlk1 protein, His & T7-tagged | +Inquiry |
| DLK1-12023H | Recombinant Human DLK1, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DLK1-6909HCL | Recombinant Human DLK1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DLK1 Products
Required fields are marked with *
My Review for All DLK1 Products
Required fields are marked with *



