Recombinant Human DLL3 Protein (27-492 aa), His-tagged
Cat.No. : | DLL3-1719H |
Product Overview : | Recombinant Human DLL3 Protein (27-492 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Developmental Biology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 27-492 aa |
Description : | Inhibits primary neurogenesis. May be required to divert neurons along a specific differentiation pathway. Plays a role in the formation of somite boundaries during segmentation of the paraxial mesoderm. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 50.5 kDa |
AA Sequence : | AGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFFRVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTFSFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEPPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCLEGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTCPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | DLL3 delta-like 3 (Drosophila) [ Homo sapiens ] |
Official Symbol | DLL3 |
Synonyms | DLL3; delta-like 3 (Drosophila); SCDO1; delta3; |
Gene ID | 10683 |
mRNA Refseq | NM_016941 |
Protein Refseq | NP_058637 |
MIM | 602768 |
UniProt ID | Q9NYJ7 |
◆ Recombinant Proteins | ||
DLL3-2127C | Active Recombinant Cynomolgus DLL3 protein, His-tagged | +Inquiry |
DLL3-4631M | Active Recombinant Mouse DLL3 protein, His-tagged | +Inquiry |
DLL3-1719H | Recombinant Human DLL3 Protein (27-492 aa), His-tagged | +Inquiry |
RFL33772MF | Recombinant Full Length Mouse Delta-Like Protein 3(Dll3) Protein, His-Tagged | +Inquiry |
RFL36004RF | Recombinant Full Length Rat Delta-Like Protein 3(Dll3) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DLL3 Products
Required fields are marked with *
My Review for All DLL3 Products
Required fields are marked with *
0
Inquiry Basket