Recombinant Human DLL3 protein, MBP&His-Avi-tagged, Biotinylated
| Cat.No. : | DLL3-866H |
| Product Overview : | Biotinylated Recombinant Human DLL3 protein(Q9NYJ7)(429-492aa), fused with N-terminal MBP tag and C-terminal His and Avi tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Avi&His&MBP |
| Protein Length : | 429-492a.a. |
| Tag : | MBP&His&Avi |
| Conjugation/Label : | Biotin |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 54.4 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | RADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL |
| Conjugation : | Biotin |
| Gene Name | DLL3 delta-like 3 (Drosophila) [ Homo sapiens ] |
| Official Symbol | DLL3 |
| Synonyms | DLL3; delta-like 3 (Drosophila); delta (Drosophila) like 3; delta-like protein 3; SCDO1; delta3; drosophila Delta homolog 3; |
| Gene ID | 10683 |
| mRNA Refseq | NM_016941 |
| Protein Refseq | NP_058637 |
| MIM | 602768 |
| UniProt ID | Q9NYJ7 |
| ◆ Recombinant Proteins | ||
| DLL3-4632M | Recombinant Mouse DLL3 protein, His-tagged | +Inquiry |
| RFL33772MF | Recombinant Full Length Mouse Delta-Like Protein 3(Dll3) Protein, His-Tagged | +Inquiry |
| RFL36004RF | Recombinant Full Length Rat Delta-Like Protein 3(Dll3) Protein, His-Tagged | +Inquiry |
| DLL3-4631M | Active Recombinant Mouse DLL3 protein, His-tagged | +Inquiry |
| DLL3-1031H | Recombinant Human DLL3 protein(Ala27-Arg490), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DLL3 Products
Required fields are marked with *
My Review for All DLL3 Products
Required fields are marked with *
