Recombinant Human DLL3 protein, MBP&His-Avi-tagged, Biotinylated
Cat.No. : | DLL3-866H |
Product Overview : | Biotinylated Recombinant Human DLL3 protein(Q9NYJ7)(429-492aa), fused with N-terminal MBP tag and C-terminal His and Avi tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Avi&His&MBP |
Protein Length : | 429-492a.a. |
Tag : | MBP&His&Avi |
Conjugation/Label : | Biotin |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 54.4 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | RADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL |
Conjugation : | Biotin |
Gene Name | DLL3 delta-like 3 (Drosophila) [ Homo sapiens ] |
Official Symbol | DLL3 |
Synonyms | DLL3; delta-like 3 (Drosophila); delta (Drosophila) like 3; delta-like protein 3; SCDO1; delta3; drosophila Delta homolog 3; |
Gene ID | 10683 |
mRNA Refseq | NM_016941 |
Protein Refseq | NP_058637 |
MIM | 602768 |
UniProt ID | Q9NYJ7 |
◆ Recombinant Proteins | ||
DLL3-171R | Recombinant Rhesus macaque DLL3 protein, His-tagged | +Inquiry |
DLL3-5643M | Recombinant Mouse DLL3 protein, His-tagged | +Inquiry |
DLL3-4885H | Recombinant Human DLL3 protein, His-SUMO-tagged | +Inquiry |
DLL3-4632M | Recombinant Mouse DLL3 protein, His-tagged | +Inquiry |
DLL3-1119H | Recombinant Human DLL3 protein, His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DLL3 Products
Required fields are marked with *
My Review for All DLL3 Products
Required fields are marked with *