Recombinant Human DLL4 Protein, GST-tagged

Cat.No. : DLL4-2687H
Product Overview : Human DLL4 partial ORF ( NP_061947, 123 a.a. - 221 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene is a homolog of the Drosophila delta gene. The delta gene family encodes Notch ligands that are characterized by a DSL domain, EGF repeats, and a transmembrane domain. [provided by RefSeq, Jul 2008]
Molecular Mass : 36.63 kDa
AA Sequence : HAPGDDLRPEALPPDALISKIAIQGSLAVGQNWLLDEQTSTLTRLRYSYRVICSDNYYGDNCSRLCKKRNDHFGHYVCQPDGNLSCLPGWTGEYCQQPI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DLL4 delta-like 4 (Drosophila) [ Homo sapiens ]
Official Symbol DLL4
Synonyms DLL4; delta-like 4 (Drosophila); delta like 4 homolog (Drosophila); delta-like protein 4; delta4; delta 4; delta ligand 4; notch ligand DLL4; delta-like 4 homolog; delta-like 4 protein; notch ligand delta-2; drosophila Delta homolog 4; hdelta2; MGC126344;
Gene ID 54567
mRNA Refseq NM_019074
Protein Refseq NP_061947
MIM 605185
UniProt ID Q9NR61

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DLL4 Products

Required fields are marked with *

My Review for All DLL4 Products

Required fields are marked with *

0
cart-icon