Recombinant Human DLL4 Protein, GST-tagged
| Cat.No. : | DLL4-2687H |
| Product Overview : | Human DLL4 partial ORF ( NP_061947, 123 a.a. - 221 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene is a homolog of the Drosophila delta gene. The delta gene family encodes Notch ligands that are characterized by a DSL domain, EGF repeats, and a transmembrane domain. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 36.63 kDa |
| AA Sequence : | HAPGDDLRPEALPPDALISKIAIQGSLAVGQNWLLDEQTSTLTRLRYSYRVICSDNYYGDNCSRLCKKRNDHFGHYVCQPDGNLSCLPGWTGEYCQQPI |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DLL4 delta-like 4 (Drosophila) [ Homo sapiens ] |
| Official Symbol | DLL4 |
| Synonyms | DLL4; delta-like 4 (Drosophila); delta like 4 homolog (Drosophila); delta-like protein 4; delta4; delta 4; delta ligand 4; notch ligand DLL4; delta-like 4 homolog; delta-like 4 protein; notch ligand delta-2; drosophila Delta homolog 4; hdelta2; MGC126344; |
| Gene ID | 54567 |
| mRNA Refseq | NM_019074 |
| Protein Refseq | NP_061947 |
| MIM | 605185 |
| UniProt ID | Q9NR61 |
| ◆ Recombinant Proteins | ||
| Dll4-451M | Active Recombinant Mouse Dll4, His-tagged | +Inquiry |
| Dll4-2288M | Active Recombinant Mouse Dll4 protein, His-tagged | +Inquiry |
| DLL4-354H | Active Recombinant Human DLL4 protein | +Inquiry |
| DLL4-1349H | Recombinant Human DLL4 Protein, His&GST-tagged | +Inquiry |
| DLL4-4900Z | Recombinant Zebrafish DLL4 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DLL4-2507HCL | Recombinant Human DLL4 cell lysate | +Inquiry |
| DLL4-2495MCL | Recombinant Mouse DLL4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DLL4 Products
Required fields are marked with *
My Review for All DLL4 Products
Required fields are marked with *
